KEGG   Rhodopseudomonas palustris CGA009: RPA1507Help
Entry
RPA1507           CDS       T00153                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1673145..1674917
Genome map
AA seq 590 aa AA seqDB search
MSIALAWSDAVTAAQLFAVDPVGTGGVLLRSRAGPVRDRWLAMMRAALPPEQPYKHLPLH
IADGRLLGGLDLSATLLAGRPVAERGLLSEADGGVMVVAMAERLQSSTNVYLTAAMDAHE
TAVERDGLSLRMPARFGVVALDEGLEDEFSPAGLRDRLGFHLDLDQFAWRETDDFPISLD
DIRAARARLADIKVESEQIEAVCTAAAALGIISLRAPLLAIRAAKASAALFDRTKIEQDD
ITLAARLVLAPRATIFPQQEQPDQADEPPPPEPPPPEDDNQDNNDQEQQTPDIDKALDEV
ILAAVKAAMPPGVLEAMRASAGRARARSAGKAGELQKSKKRGRPAGSIRGELRDGSKLNV
IETLRAAAPWQPLRRRQAEGRNGSAPRILVEKDDFRIARFKQRTETITIFVVDASGSAAL
HRLAEAKGAVELLLADCYVRRDQVAMISFRGTIAEILLPPTRSLARAKRSLAGLPGGGGT
PLSAGLDCAFMLADSIKRKGQTPTVIVLTDGRANIARDGAPGRPQAEEDAKSSARQFRVA
GISSVVIDMSPRPGPQAEAFAKEMDARYLPMPHADATVLAQAVTAATRQD
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcgctcgcatggtccgatgcggtgaccgcggcgcagttgttcgcggtcgat
ccggtcggtaccggcggtgtgttgttgcgctcacgcgccggcccggtgcgcgatcgctgg
ctcgcaatgatgcgggccgcgctgccgcctgaacaaccctataagcatcttccgctgcat
atcgccgacggccgcctgctcggtggactggatctgtctgcgacgctgctcgccggccgg
ccggtcgccgagcgcggcctgctgtcggaagccgacggcggcgtgatggtggtggcgatg
gccgagcggctgcagtcctcgaccaacgtttatctgaccgcagctatggacgcgcacgaa
accgcggtggagcgcgacggcctgtcgctgcggatgccggcccggttcggtgtggtcgcg
ctcgacgaaggcctcgaggacgagttctcgccggcgggtctgcgcgaccggctcggcttc
catctcgatctcgatcagttcgcctggcgcgagaccgacgacttcccgatctcgctcgac
gacatccgcgccgctcgcgcgcggctcgccgatatcaaggtcgagagtgagcagatcgag
gccgtgtgcacggcggccgcagcgctcggcatcatctcgctgcgagcgccgctgctggcg
atccgcgccgccaaggcgagcgctgctctgttcgatcgcaccaagatcgaacaggacgac
atcacgctcgccgcgcgcctggtgctggcgccgcgtgcgacgatcttcccgcagcaggag
cagccggatcaggccgacgagccgccgccgcccgagccgcctccgccggaagacgacaat
caggacaacaacgatcaggaacagcagacgcctgatatcgacaaggcgctggacgaggtg
atcctcgccgccgtcaaggctgcgatgccgcccggcgtgctggaggcgatgcgcgcctcg
gccggacgcgcgcgtgcccgctcggccggcaaggccggcgaactgcagaagtcgaagaag
cgtggccgccccgccggcagcatccgcggcgaactgcgcgacggctccaagctcaacgtg
atcgagacgctgcgggccgcagcgccgtggcagccgctgcggcggcgccaggccgaggga
cgcaacggcagcgcgccgcgcatcctggtcgagaaggacgatttccggatcgcgcgcttc
aagcagcgcaccgagaccatcaccatcttcgtggtcgatgcgtcggggtctgcggctttg
caccggctcgccgaagccaagggcgcggtcgagttgttacttgcggattgctatgtccgc
cgcgatcaggtggcgatgatctcgttccgcggcaccatcgccgagatcctgctgccgccg
acgcggtcgctcgcgcgcgccaagcgcagcctcgccggcctgccgggcggcggcggcacg
ccgctgtcagccgggctcgactgcgcgttcatgctggcggattcgatcaagcgcaaaggc
cagacgccgacggtgatcgtgctcaccgatggccgcgccaacatcgcgcgtgacggcgca
ccgggccggccgcaggctgaggaagacgccaagtcgtcggcgcggcagttccgcgtcgcc
ggaatcagctctgtggtgatcgacatgtcgccgcgtccggggccgcaggcggaagccttt
gccaaggaaatggacgcgcgctatctgccgatgccgcatgccgacgccaccgtactggcg
caggcggtgacggccgcgacccggcaggactga

DBGET integrated database retrieval system