KEGG   Rhodopseudomonas palustris CGA009: RPA1535Help
Entry
RPA1535           CDS       T00153                                 

Gene name
cycA
Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa01100  Metabolic pathways
rpa01120  Microbial metabolism in diverse environments
rpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPA1535 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CAE26977
CyanoBase: RPA1535
CYORF: RPA1535
UniProt: P00091
Structure
PDB: 

Jmol
Position
complement(1703088..1703507)
Genome map
AA seq 139 aa AA seqDB search
MVKKLLTILSIAATAGSLSIGTASAQDAKAGEAVFKQCMTCHRADKNMVGPALGGVVGRK
AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKKFLTDKGKADQAVGVTKMTF
KLANEQQRKDVVAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaaaaacttctcacaattctcagcatcgccgctaccgccggatctctgtcgatc
ggcactgcctcggcccaggacgccaaggcgggtgaggcggtgttcaaacagtgcatgacc
tgccaccgcgccgacaagaacatggtcggtccggctctgggcggcgtcgtcggtcgtaag
gccggtaccgcggctggcttcacctattcgccgctgaaccacaattcgggtgaagcgggt
ctggtctggaccgccgacaacatcatcaactacctgaacgatccgaacgcgttcctgaag
aagttcctgaccgataagggtaaggctgatcaggcggtcggtgtcaccaagatgaccttc
aagctcgccaacgagcagcagcgtaaggacgtggtcgcctatctggccaccctcaagtaa

DBGET integrated database retrieval system