KEGG   Rhodopseudomonas palustris CGA009: RPA1544Help
Entry
RPA1544           CDS       T00153                                 

Gene name
bchH
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPA1544 (bchH)
Enzymes [BR:rpa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPA1544 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1712857..1716603
Genome map
AA seq 1248 aa AA seqDB search
MPKRTSPADKTPVRVVIVTLDSHLSGAAARARNVLRKDYPGIELTVHSADEWGSDGHALQ
RCLADIATGDIIIATMLFMDDHVRAVMPALQARRTECDAMVCCMSASEVVKLTHIGKFDM
SAEALGMINWLKKLRGKKHEGSAGKGEMKMLRQLPKLLRFVPGTAQDMRAYFLTLQYWLA
GCEQNIANMVRLLIDRYASGPRKGLRGVAKVEPPLEYPDIGVYHPKMKGRIAESVDKLPT
GPSEAKGTVGVLLLRSYLLAGNAGHYDGMLETFEAKGLRVIPVFASGLDQRPAIEQFFIK
NGRPTVDAVVSLTGFSLVGGPAYNDSKAAEDILAALDVPYLSAHPVEFQTLEQWATSDRG
LMPVESTIMVAIPELDGCSNPMVYGGRSDGGDVACPGCEKFCKFERNESGGDMHVCSERA
EMLASRTAKLVALRRSERKDRKVAAVLFNFPPNAGNTGTAAFLGVFESLFNTLKAMKAEG
YTVEVPESVDALREAIINGNAARFGANANVHARVMAGDHVKNERYLREIEAQWGPAPGKQ
QSDGSSIFILGERFGNVFVGVQPAFGYEGDPMRLLFEKGFAPTHAFSAFYRWIKQDFGAH
AVLHFGTHGALEFMPGKQTGLSGTCWPDRMIGDLPNMYLYASNNPSEGAIAKRRSAATLV
SYLTPPVAHAGLYRGLLELKSSLERWRGLTPEEETERANLATLVQAQAAGLDLAPAEPAW
TAEEAGATIAKLADSVLEMEYALIPHGLHVVGNVPSEEERVETLEAVADAMHGKRPDKSL
LEALVRGGHPEHLSGNGPEAQANLDMLKELAGIDKLLAEDHELAAILRALDGKFIRPAPG
GDLLRTPAVLPTGRNLHGFDPFRIPSAYALQDGAKQAQRLIDKHIAEGNPLPETVAIVLW
GTDNLKNEGAPIGQALALMGARPRFDGYGRLAGADLIPLEELGRPRIDVIITMSGIFRDL
LPLQIKLLAEAAFMAASAEEPAEQNFIRKHSLAYQAEHKCDMETASLRVFGNADGAYGSN
VNHLVENSRWEDEDELAETYTKRKSFAYGLKGQPVQHAELLKSALADVDLAYQNLDSVEL
GVTTVDHYFDTLGGISRAVRKAKGGQAAPVYIGDQTRGAGTVRTLSEQVALETRTRMLNP
KWYEGMLKHGYEGVRQIEEHVTNTMGWSATTGEVAPWVYKQLTETFVLDPEMRARLAALN
PVASAKVANRLIEAHERNYWSPDPEMLETLRKAGEELEDRLEGVGVAA
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcgcacttcgcccgctgacaagaccccggttcgggtcgtcatcgtcacgctg
gacagccatttgtccggtgccgccgcacgtgctcgcaacgtgttgcggaaggattatccc
ggaatcgagctgacggtgcactccgccgacgagtgggggagcgacggacacgcgctgcag
cgctgcctcgccgacatcgccaccggcgacatcatcattgccaccatgctgttcatggac
gatcacgtccgtgcggtaatgccggcgctgcaggcgcggcgtaccgaatgcgacgcgatg
gtgtgctgcatgtcggcctccgaggtggtgaagctcacccacatcggcaagttcgacatg
agcgccgaagcgctcggcatgatcaattggctgaagaagctgcgcggcaagaagcacgaa
ggctcggccggcaagggcgagatgaagatgctgcggcagctgccgaagctgctccgcttc
gtgcccggcaccgcgcaggacatgcgcgcctacttcctgacgctgcagtactggctggcc
ggttgcgagcagaacatcgccaacatggtgcggctgctgatcgaccgctacgcgagcggt
ccgcgcaagggtctgcgcggcgtcgccaaggtcgagccgccgctcgaatatcccgatatc
ggcgtgtaccacccgaagatgaagggccggattgccgagtcggtcgacaagctgccgacg
ggcccgagcgaggccaagggcacggtcggcgtgctgctgctgcgctcctatctgctcgcc
ggcaatgccgggcattatgacggcatgctggagacgttcgaggccaagggcctgcgcgtg
attcctgtgttcgcctcgggcctcgatcagcgcccggcgatcgagcagttcttcatcaag
aacggccgtcccacggtcgatgcggtggtgtcgctcaccggcttctcgctggtcggcggt
cccgcctacaacgactccaaggcggccgaagacatcctcgccgcgctcgacgtgccgtat
ctgtcggcgcatccggtcgagttccagacgctggagcagtgggcgacgtccgatcgcggc
ctgatgccggtggaaagcaccatcatggtggcgatccccgagctcgacggctgctccaac
ccgatggtctatggcggccgctccgacggcggcgacgtcgcctgcccgggctgcgagaag
ttctgcaagttcgagcgcaacgaaagcggcggcgacatgcatgtctgcagcgagcgcgcc
gaaatgctggcgtcgcgcaccgccaagctggtggcgctgcgccggagcgaacgcaaggac
cgcaaggtcgcggcggtgctgttcaacttcccgccgaacgccggcaacaccggcaccgcg
gcgttcctcggcgtgttcgagtcgctgttcaacacgctgaaggcgatgaaggccgaaggc
tacaccgtcgaagtgcccgaaagcgtcgacgcgttgcgcgaggcgatcatcaacggcaat
gcggcacggttcggcgccaatgccaacgttcatgcccgcgtgatggccggcgatcacgtc
aagaacgaacgctatctgcgggagatcgaagcgcagtggggtccggcgcccggcaagcag
cagagcgacggctcgtcgatcttcattctcggcgagcgcttcggcaacgtgttcgtcggc
gtgcagccggcgttcggttacgaaggcgacccgatgcggctgctgttcgagaaggggttt
gcgccgacgcacgccttctcggcgttctatcgctggatcaagcaggacttcggcgcccat
gcagtgctgcatttcggcacccacggtgcgctggaattcatgcccggcaagcagaccggc
ctgtccggcacctgctggcctgatcgcatgatcggcgatctgccgaacatgtatctgtac
gcctccaacaacccgtccgaaggcgcgatcgccaagcggcgttcggcggcgacgctggtc
agctacctgaccccgccggtcgcgcatgccggcctgtatcgcgggctgctcgagctgaag
tcttcgctggagcgctggcgcggcctgacgccggaggaagagaccgagcgcgcgaatctc
gcgacgctggtgcaggcgcaggccgccggcctcgacctcgccccggccgaaccggcctgg
accgccgaagaggcgggggcgaccatcgccaagctcgccgactccgtgctcgagatggaa
tacgcgctgatcccgcacggcctccatgtggtcggcaacgtgccgtccgaagaggagcgg
gtcgagacgctggaagccgttgcggatgcgatgcacggcaagcggccggacaagtccttg
ctcgaagcgctggtgcgcggcggtcatcccgagcatctgtccgggaatggtcccgaggct
caggccaatctcgacatgctcaaggagctggccgggatcgacaagctgctcgccgaggat
cacgaactcgccgcgatcctgcgcgcgctcgacggcaagttcatccgtccggcgccgggc
ggcgacctgctgcgcacgcccgcggtgctgccgaccggccgcaacctgcacggcttcgat
ccgttccggattccgtcggcctacgcgctgcaggacggcgccaagcaggcgcagcggctg
atcgacaagcacatcgccgagggcaatccgctgcccgagacggtcgcgatcgtgctgtgg
ggcactgacaacctcaagaacgaaggcgcaccgatcggccaggcgctggcactgatgggc
gcccggccgcggttcgacggctacggccgtctcgccggcgccgacctgatcccgctcgaa
gagctgggccggccgcgcatcgacgtgatcatcaccatgtcgggcatcttccgcgacctg
ctgccgctgcagatcaagctgctcgccgaagccgccttcatggcggcgagcgccgaggag
ccggccgagcagaacttcatccgcaagcattcgctggcctatcaggccgagcacaaatgc
gacatggagaccgcgtcgctgcgggtgttcggcaatgccgacggtgcctacggctccaac
gtcaaccatctggtcgagaacagccgctgggaagacgaggacgagctcgccgagacctat
accaagcgcaagagcttcgcttacggtctcaagggccagccagtgcagcacgccgaactg
ctcaagagcgcgctcgccgacgtcgatctcgcctatcagaacctcgactcggtcgagctc
ggcgtcaccaccgtcgatcactacttcgacacgctcggcggcatcagccgcgcggtgcgc
aaggcgaagggcggccaggctgcgccggtgtatatcggcgaccagacccgcggcgccggt
accgtccggacgctgtcggagcaggtcgcactcgagactcgcactcggatgctaaatccg
aagtggtacgagggcatgctcaagcatggctacgaaggcgtgcgccagatcgaagagcac
gtcacaaatactatgggctggtcggcaaccacgggtgaagtcgcgccgtgggtgtacaag
cagctcaccgagaccttcgtgctcgaccctgaaatgcgggcacgcctcgccgcgctcaat
ccggtggcttcggcgaaggtcgccaaccgcctgatcgaagcgcacgaacgcaactactgg
tctccggacccggaaatgctcgagaccctgcgcaaggcaggcgaagagctcgaggatcgc
ctggaaggcgtgggagtggccgcatga

DBGET integrated database retrieval system