KEGG   Rhodopseudomonas palustris CGA009: RPA1594Help
Entry
RPA1594           CDS       T00153                                 

Gene name
trpB-1
Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA1594 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA1594 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPA1594 (trpB-1)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPA1594 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1771765..1773129
Genome map
AA seq 454 aa AA seqDB search
MSDQIKYVLDEENIPKSWYNLNADFPTPMPPVLHPGTHQPVGPSDLEPLFPMELILQEVA
TERYIEIPEPVRDVFRMWRPAPLIRARRLEQALGTPAKIYFKYEGVSPAGSHKPNTAVPQ
AWYNKQAGIKKLSTETGAGQWGSSLAFAGSLFGLDVLVFQVRVSYDQKPYRRALMETYGA
RCIASPSNETDSGRAILEKNPNSPGSLGIAISEAVEVAAKNPDIKYALGSVLNHVMLHQT
IIGEEAIKQFEMAGDDPDVVIGCAGGGSNFAGLAFPFLGLQLRGGRKRRIIAVEPAACPT
LTRGTYAYDFGDTAHLTPLVKMHTLGSTFMPPGFHAGGLRYHGMSGMVSHAYELGLIEAR
AYKQVGCFEAGVQFARTEGIVPAPESTHAVRCAIDEALRCKEEGKSETILFNLSGHGHFD
MQAYINYFEGKLVDQDYDEADLATALAGLPAVAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagatcaagtatgtgctggacgaggagaacatcccgaagtcctggtacaat
ctcaacgccgacttcccgacgccgatgccgccggtcctgcatccgggcacgcatcagccg
gtcggcccgagcgatctggagccgctgtttccgatggagctgatcctccaggaagtcgcg
accgagcgctacatcgagattcccgagccggtccgtgacgtgttccggatgtggcgcccg
gcgccgctgatccgtgcgcgccgcctcgagcaggcgctcggcacgccggccaagatctac
ttcaagtacgaaggcgtttcgcctgccggttcgcacaagccgaacactgccgtgccgcag
gcctggtacaacaagcaggccggcatcaagaagctgtcgaccgagaccggtgccgggcag
tggggctcgtcgctggcgttcgccggctcgctgttcgggctcgacgtcctcgtcttccag
gtccgcgtgtcgtacgaccagaagccgtatcgccgcgcgctgatggagacctacggcgcc
cgctgcatcgcgtcgccgtcgaacgagaccgattccggccgcgccattcttgagaagaat
ccgaacagccccggctcgctcggcatcgcgatctccgaagcggtggaagtcgctgcgaag
aacccggacatcaagtacgcgctgggttcggtgctcaaccacgtgatgctgcaccagacc
atcatcggcgaagaagcgatcaagcagttcgagatggcgggcgatgatccggacgtggtg
atcggctgcgccggcggcggttcgaacttcgccggtcttgccttcccgttcctcggcctg
cagctccgcggcggccgcaagcggcgcatcatcgcggtcgaaccggcggcgtgcccgacc
ctgacccgcggcacctatgcctacgacttcggcgacaccgcgcatctcaccccgctggtg
aagatgcatacgctcggctcaaccttcatgccgccgggcttccacgccggcggtctgcgc
taccacggcatgagcgggatggtgtcgcacgcctacgaactcggcctgatcgaagcccgc
gcctacaagcaggtcggctgcttcgaagccggcgtgcagttcgcccgcaccgaaggcatc
gtgccggcgccggagtccacccacgcggtccgctgcgccatcgacgaggcgctgcgctgc
aaggaggagggcaagtcggaaacgatcctgttcaacctctccggccacggccacttcgac
atgcaggcctacatcaactacttcgaaggcaagctggtcgatcaggactacgacgaagcc
gacctcgccactgcgctggccggcctgccggcggtggcggcgtaa

DBGET integrated database retrieval system