KEGG   Rhodopseudomonas palustris CGA009: RPA1594Help
Entry
RPA1594           CDS       T00153                                 

Gene name
trpB-1
Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA1594 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA1594 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPA1594 (trpB-1)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPA1594 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1771765..1773129
Genome map
AA seq 454 aa AA seqDB search
MSDQIKYVLDEENIPKSWYNLNADFPTPMPPVLHPGTHQPVGPSDLEPLFPMELILQEVA
TERYIEIPEPVRDVFRMWRPAPLIRARRLEQALGTPAKIYFKYEGVSPAGSHKPNTAVPQ
AWYNKQAGIKKLSTETGAGQWGSSLAFAGSLFGLDVLVFQVRVSYDQKPYRRALMETYGA
RCIASPSNETDSGRAILEKNPNSPGSLGIAISEAVEVAAKNPDIKYALGSVLNHVMLHQT
IIGEEAIKQFEMAGDDPDVVIGCAGGGSNFAGLAFPFLGLQLRGGRKRRIIAVEPAACPT
LTRGTYAYDFGDTAHLTPLVKMHTLGSTFMPPGFHAGGLRYHGMSGMVSHAYELGLIEAR
AYKQVGCFEAGVQFARTEGIVPAPESTHAVRCAIDEALRCKEEGKSETILFNLSGHGHFD
MQAYINYFEGKLVDQDYDEADLATALAGLPAVAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagatcaagtatgtgctggacgaggagaacatcccgaagtcctggtacaat
ctcaacgccgacttcccgacgccgatgccgccggtcctgcatccgggcacgcatcagccg
gtcggcccgagcgatctggagccgctgtttccgatggagctgatcctccaggaagtcgcg
accgagcgctacatcgagattcccgagccggtccgtgacgtgttccggatgtggcgcccg
gcgccgctgatccgtgcgcgccgcctcgagcaggcgctcggcacgccggccaagatctac
ttcaagtacgaaggcgtttcgcctgccggttcgcacaagccgaacactgccgtgccgcag
gcctggtacaacaagcaggccggcatcaagaagctgtcgaccgagaccggtgccgggcag
tggggctcgtcgctggcgttcgccggctcgctgttcgggctcgacgtcctcgtcttccag
gtccgcgtgtcgtacgaccagaagccgtatcgccgcgcgctgatggagacctacggcgcc
cgctgcatcgcgtcgccgtcgaacgagaccgattccggccgcgccattcttgagaagaat
ccgaacagccccggctcgctcggcatcgcgatctccgaagcggtggaagtcgctgcgaag
aacccggacatcaagtacgcgctgggttcggtgctcaaccacgtgatgctgcaccagacc
atcatcggcgaagaagcgatcaagcagttcgagatggcgggcgatgatccggacgtggtg
atcggctgcgccggcggcggttcgaacttcgccggtcttgccttcccgttcctcggcctg
cagctccgcggcggccgcaagcggcgcatcatcgcggtcgaaccggcggcgtgcccgacc
ctgacccgcggcacctatgcctacgacttcggcgacaccgcgcatctcaccccgctggtg
aagatgcatacgctcggctcaaccttcatgccgccgggcttccacgccggcggtctgcgc
taccacggcatgagcgggatggtgtcgcacgcctacgaactcggcctgatcgaagcccgc
gcctacaagcaggtcggctgcttcgaagccggcgtgcagttcgcccgcaccgaaggcatc
gtgccggcgccggagtccacccacgcggtccgctgcgccatcgacgaggcgctgcgctgc
aaggaggagggcaagtcggaaacgatcctgttcaacctctccggccacggccacttcgac
atgcaggcctacatcaactacttcgaaggcaagctggtcgatcaggactacgacgaagcc
gacctcgccactgcgctggccggcctgccggcggtggcggcgtaa

DBGET integrated database retrieval system