KEGG   Rhodopseudomonas palustris CGA009: RPA1596Help
Entry
RPA1596           CDS       T00153                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA1596
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA1596
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPA1596
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPA1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1774809..1775177
Genome map
AA seq 122 aa AA seqDB search
MASGYWSRRRKAHSEGGRYCEVRLIEARAYKQVGCFEAGVQFARTEGIVPAPESTHAVRC
AIDEALRCKEEGKSETILFNLSGHGHFDMQAYINYFEGKLVDQDYDEADLATALAGLPAV
AA
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtggttattggtcgcggcgaagaaaggcgcattctgaaggtggtagatattgc
gaagtccgcctgatcgaagcccgcgcctacaagcaggtcggctgcttcgaagccggcgtg
cagttcgcccgcaccgaaggcatcgtgccggcgccggaatcgacccacgcggtgcgttgc
gcgatcgacgaggcgctgcgctgcaaggaggagggcaagtcggaaacgatcctgttcaac
ctctccggccacggccatttcgacatgcaggcctacatcaactacttcgaaggcaagctg
gtcgatcaggactacgacgaagccgacctcgccaccgcgctggccggcctgccggcggtg
gcggcgtaa

DBGET integrated database retrieval system