KEGG   Rhodopseudomonas palustris CGA009: RPA1630Help
Entry
RPA1630           CDS       T00153                                 

Gene name
cheB2
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPA1630 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RPA1630 (cheB2)
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RPA1630 (cheB2)
Two-component system [BR:rpa02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RPA1630 (cheB2)
Bacterial motility proteins [BR:rpa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RPA1630 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1811072..1812247
Genome map
AA seq 391 aa AA seqDB search
MSVALAGSPATNSAQYEPLRVMIVDDSVVIRGLISRWVEAEPDMVVAASLRTGLDAVNQL
ERVKPDVAVLDIEMPELDGISALPQLLAKKRDLVVIMASTLTRRNAEISFKALSLGAADY
IPKPETTREPQAADIFKHDLLQKIRSLGGRVRRRAVPGVAAPAIAREPHPAPLPHPAVAT
PTVASQAALVKRSFGPTAPRVLLIGSSTGGPQALMSMVADIGPVIDRFPVLITQHMPPTF
TTILAEHLARASRRPAHEGIEGEAIKPGNIYLAPGGKHMRVAKQGGNPVIALDDGPPVNF
CKPAVDPLFMSAIEVWQGGILAVVLTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMP
GAVANAGVCAAVLPLNQIGPKVVRLFAGDRS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagctttggcaggtagtcccgctacgaattcggcgcaatacgagccgttgcgc
gtgatgatcgtcgacgactcggtcgtcatccgcggcttaatctccagatgggtcgaggct
gagccggatatggtggtggcggcctcgctgcgcaccgggcttgacgccgtcaatcagctt
gaacgggtcaagccggacgttgctgtgctcgacatcgaaatgccggaactcgacggcatt
tcggcgttgccgcagttgcttgccaaaaagcgcgatctggttgtgatcatggcgtcgacg
ctgacccgccgcaacgcggagatcagcttcaaggcgctctcgctcggcgccgccgattac
attccgaagccggaaaccactcgcgagccgcaggccgccgacatctttaagcacgatctg
ctgcagaagatccgttcgctcggcggccgggttcgtcgccgcgccgtacccggagtagct
gcgccggcgatcgcgcgtgaaccgcatccggcgccgctgccgcatcccgcagtggctact
ccgaccgttgccagccaagctgcgctggtgaagcgctcgttcggtccgaccgcgccgcgc
gttctactgatcggctcgtcgaccggtgggccgcaggcgctgatgtcgatggtggccgat
atcggtccggtgatcgatcgttttcccgtgctgatcacccagcacatgccgccgaccttc
acgaccatcctggccgagcaccttgcgcgtgccagtcggcgcccggcgcatgaaggcatc
gaaggcgaagccatcaagcccggtaacatctatctcgcccccggcggcaagcacatgcgc
gtcgccaagcagggcggcaatccggtgatcgcgctcgacgacggcccgccggtgaacttc
tgcaagcctgcggtcgatccgctgtttatgtctgcgatcgaagtgtggcagggcggcatt
ctcgccgtggtgctgaccggcatggggtcggacggtatgcgcggcggcaaggacatcgtc
gccgctggcggcagcgtgatcgcccaggacgaagcctccagcgtggtctggggcatgccg
ggtgcggtcgccaatgcaggcgtctgcgccgcggtgctgccgctcaatcagatcgggccc
aaagtggtgcgcctgttcgcaggagaccgctcgtga

DBGET integrated database retrieval system