KEGG   Rhodopseudomonas palustris CGA009: RPA1840Help
Entry
RPA1840           CDS       T00153                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2067136..2067993)
Genome map
AA seq 285 aa AA seqDB search
MTASPSLPASPAAPAKPSQLRDLLARPAAAVMGILNVTPDSFSDGGDYLAPEQACAHAAE
MIADGAEIIDIGAESTRPYGSQPVSAAEELRRLQPVLEAVVALGTPVSIDTMKADVAAWA
LDHGAAIANDVWGLQRDPEMAGVIAARRAPVIMMHNRDAADPAIDIVADINAFFERSMTI
ATKAGIAEELIVLDPGIGFGKTPQQSMITLARLREFASFGRPLLVGASRKRFISTVVPSE
PKQRLGGSLAAHLIAVENGAKIIRAHDVAATSQALKVAHAIRDSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctccccatcgttgcccgcatcgcccgccgctccggccaagccgtcacagctg
cgcgatctgctggcgcgtcccgccgcggcggtgatgggcattctcaacgtcacaccggat
tctttctccgacggcggcgattatctcgcccccgagcaggcctgcgcccatgcggccgag
atgatcgccgatggcgccgagatcatcgacatcggtgcggagtccacccgcccctacggc
tcgcagccggtgtccgccgctgaagagctgcggcggctacagccggtgctggaagcggtg
gtcgcgctcggcacgccggtgtcgatcgacaccatgaaggccgacgtcgccgcgtgggca
ctcgaccatggcgcggcgattgccaatgacgtttggggactgcagcgcgatccggagatg
gcgggcgtgattgcagcgcgccgcgccccggtgatcatgatgcacaatcgcgacgcggcc
gatccagccatcgacatcgtcgccgacatcaacgcgttcttcgaacgttcgatgacgatc
gccacgaaggccgggatcgccgaggagctgatcgtgctcgatcccggcatcggcttcggc
aagacgccgcagcagagcatgatcacgctggcgcggctgcgcgagttcgcaagcttcggc
cgtccgctgctggtcggcgcctcacgcaagcgtttcattagtacggtggtgccgagcgag
ccgaagcaacggctcgggggttcgctcgccgcacatctgattgccgtcgagaacggcgcc
aagatcatccgcgcgcacgacgtcgccgcgacgtcgcaggcactgaaagtcgcccacgcc
atcagggacagccgatga

DBGET integrated database retrieval system