KEGG   Rhodopseudomonas palustris CGA009: RPA2018Help
Entry
RPA2018           CDS       T00153                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPA2018
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA2018
  Lipid metabolism
   00071 Fatty acid degradation
    RPA2018
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPA2018
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPA2018
   00626 Naphthalene degradation
    RPA2018
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPA2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2273049..2274071)
Genome map
AA seq 340 aa AA seqDB search
MRALTLVADRNLVVADLPSPPPPAAGEVQVRIAAVALNHIDVWGYRGMAFVKRKLPIVVG
AEASGTIEAVGDGVTAFKPGQKVVMYGALTCGHCKACQEGRDNLCENVGGLIGFHVDGFA
RELMNIAARLVIPVPDAVDLRDAACAPIAFSTVQHMLFDNAKLQPGETVLVHAGGSGIGT
VAIMMAKAIGCTVITTVGDDSKIEGVKKLGADHVINYRQDRFEHECRKITKKKGVDVVFE
HVGADTFNGSLLSLKRGGRLVTCGSTSGPTTTLNLMQLFQQQYKIFGSFGATMKNIAESL
DKMAAGMLPVIDTEVPLDDVGAALKRMESRQVFGKIIVRF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcaccctcgttgccgaccgcaatctcgtggtcgccgacctgccgtctccc
ccgcccccggcggccggcgaggtgcaggtccgcatcgccgccgtggcgctgaaccacatc
gacgtgtggggctatcgcggcatggccttcgtcaagcgcaagctgccgatcgtcgtcggc
gccgaagcctccggcacgatcgaagccgtcggtgacggcgtcaccgcgttcaagcccggg
cagaaggtcgtgatgtacggcgcgctgacctgcgggcactgcaaggcgtgccaggaaggc
cgcgacaatctctgcgaaaacgtcggcggcctgatcggtttccatgtcgacggcttcgcg
cgcgagctgatgaacatcgcggcgcggctggtgatcccggtgccggacgccgtcgacctg
cgcgacgccgcctgcgcgccgatcgccttctcgaccgtgcagcacatgctgttcgacaat
gccaagctgcagcccggcgaaaccgtgctcgtccatgccggcggctccggcatcggaact
gtggcgatcatgatggcgaaggcgatcggctgcacggtgatcaccaccgtcggcgatgat
tccaagatcgagggcgtcaagaagctcggcgccgatcacgtcatcaactatcgccaggat
cgcttcgagcacgagtgccgcaagatcaccaagaagaagggtgtcgacgtggtgttcgaa
cacgtcggtgccgacactttcaacggctcgctgctcagcctgaagcgcggcggccggctg
gtgacctgcggctcgacctcgggcccgaccacgaccctcaacctgatgcagctgttccag
cagcagtacaagatcttcggctcgttcggcgcgacgatgaagaacatcgccgaaagcctc
gacaagatggcggccgggatgctgccggtgatcgacaccgaagtgccgctcgacgatgtc
ggcgccgcactgaagcgtatggaaagccgccaggtgttcggcaagatcatcgtccggttc
tga

DBGET integrated database retrieval system