KEGG   Rhodopseudomonas palustris CGA009: RPA2061Help
Entry
RPA2061           CDS       T00153                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RPA2061 (nosZ)
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RPA2061 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2322735..2324672
Genome map
AA seq 645 aa AA seqDB search
MGDQDHEHGLSRRTLLGSSAVAAGVGLVGGATLGTGGTLIATAEAQTKPSSPARPAIQKS
EVHPGELDEYYVFFSSGQTGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKILTEG
LLPESREFLKTRGGTYVNGDLHHPHLSFTEGTYDGRYAFMNDKANTRVARVRLDVMKCDK
IIQLPNQHTVHGLRVQKYPRTGYVFCNGEDRVPLPNDGHNLKKTKDYHAIFTAVDGDTMK
VAWQVMVDGNLDNVDADYQGKYAFATCYNSEEGVTAAEMTANDQDWVVIFNLKRIEEAVK
KGDFKEMGGVPVIDGRHGSPYTRYVPVPNGPHGMNTAPDGIHIVANGKLSPTVTVMDVRL
FDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNGYTTLFIDSQICKWNIDLAKRAYKG
EKVNPIIDKLDVHYQPGHNHTSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQLID
ISGEKMKLVHDGPSFAEPHDATIVHRSKINPISVWDRADPMFSDAVKQAQADGVKLEEDS
KVIRDSDKVRVYIVATAPNFGLTEFDVKQGDHVTVYVTNIDTVEDLTHGFSIVNYGIQME
VAPHATASVSFTADRPGVYWYYCSWFCHAMHMEMKGRMLVEPRSV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccaggatcacgaacacggccttagccgacgaacgctactcggaagcagtgcc
gtcgcagccggcgtcggcctcgtcggcggcgccaccctcggcaccggcggcacgctgatc
gccactgccgaagcgcagacgaagccgagcagcccggcgcgcccggcgattcagaagagc
gaagtccacccgggcgagctcgacgagtactacgtgttcttctccagcggccagaccggc
gagctccggatcgtcggtctgccgtcgatgcgcgaactgatgcgggtcccggtgttcaac
cgctgcagcgccaccggctggggccagaccaatgagagcctcaagattttgaccgagggc
ctgctgccggaaagccgcgagttcctgaagacccgtggtggcacctatgtcaatggcgac
ctgcatcacccgcatctgtcgttcaccgagggtacctatgacggccgctacgccttcatg
aacgacaaggccaatacccgtgtggcgcgggtccggctcgacgtgatgaagtgcgacaag
atcatccagctgccgaaccagcacaccgtgcacggcctgcgcgtccagaaatatccgcgc
accggctacgtgttctgcaacggcgaagaccgcgttccgctgccgaacgacggccacaac
ctgaagaagaccaaggactaccacgcgatcttcaccgcggtcgacggcgacaccatgaag
gtggcctggcaggtgatggtcgacggcaacctcgacaacgtcgatgccgactaccaggga
aaatacgcgttcgcgacctgctacaactcggaggaaggtgtcaccgccgccgaaatgact
gccaacgaccaggactgggtggtgatcttcaatctgaagcggatcgaagaggcggtgaag
aagggcgacttcaaggaaatgggtggcgtaccggtgatcgatggccgccacggctcgccc
tacacccgctacgtgccggtgccgaacggcccgcacggcatgaacaccgcgccggacggc
atccacatcgtcgccaacggcaagctgtcgccgaccgtgacggtgatggacgtgcggctt
ttcgaccagctgttcgacgacaagatcaagccgcgtgacgtcgtggtcgccgagccggag
ctgggcctcggcccgctgcacactgcctatgacggcaagggcaacggctacaccacgctg
ttcatcgacagccagatctgcaagtggaacatcgatttggccaagcgcgcctacaagggc
gagaaggtcaatccgatcatcgacaagctcgatgtgcactatcaacccggccacaaccac
acctcgatgggccagaccaaggaagccgatggaaagtggctaatctcgctgaacaagttc
tccaaggaccggttcctcaacgtcggcccgctgaagccggagaacgatcagctgatcgac
atttctggcgagaagatgaagcttgtgcacgacggcccgagcttcgcggagccgcacgac
gcgaccatcgtccatcgctccaaaatcaatccgatctcggtctgggatcgggccgatcca
atgttctccgatgcggtgaaacaggctcaagccgacggcgtgaagctggaggaagactcc
aaggtgatccgcgacagtgacaaggtgcgggtctatatcgtggcgaccgcgccgaacttc
ggtctcaccgagttcgacgtgaagcagggcgatcacgtcaccgtctatgtcaccaacatc
gatacggtcgaagacctcacccacggcttctcgatcgtcaactacggcatccagatggaa
gtcgcgccgcacgcgactgcgtcggtgtcgttcacggccgatcgtcccggtgtgtactgg
tattattgctcctggttctgtcatgccatgcacatggagatgaagggccgcatgctggtc
gaaccgcggagcgtctga

DBGET integrated database retrieval system