KEGG   Rhodopseudomonas palustris CGA009: RPA2580Help
Entry
RPA2580           CDS       T00153                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpa  Rhodopseudomonas palustris CGA009
Brite
Enzymes [BR:rpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPA2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2934119..2934784
Genome map
AA seq 221 aa AA seqDB search
MLEFERARQNMVDGQIRPASVTDWRIIDAMRALPREAFVPESKRELVYLDLDLQIEGRDD
HKHFLLNPIMTARMLQAAELQHDDRVLVVGCPTGYIAAVAAKLAARVTTTIDDESLAQRI
RATLPALGLSNVNVRVAEAAKGDLHDAPFDAILLCGATEVEPTTLYEQLKLGGRLVGAFA
TGRPQRVTVVTRSHGDYGARILFDASIPVLPGLERVPVFEF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttggaattcgagcgcgcacggcaaaacatggtcgatgggcaaatccggcctgccagc
gtgacggattggcgaatcatcgatgcgatgcgggcgctgccgcgcgaggcctttgttccg
gaatcaaagcgcgagctggtctatctcgatctcgaccttcagatcgaaggccgcgacgac
cacaagcacttcctgctcaatccgatcatgaccgcccgtatgctgcaggccgccgagctg
cagcatgatgatcgcgtcctcgtggtcggatgcccgacgggctacatcgctgcggtggcg
gccaagctcgccgcacgggtgaccaccacgatcgatgacgaatcgctggcgcagcgcatt
cgcgcgacgctgcccgcgctcggtctgtccaacgtcaacgtccgggtcgccgaagcggcg
aagggcgatctgcacgacgcgccgttcgatgccatcctgttgtgcggcgccaccgaggtc
gagccgaccacgctttatgagcagctcaagctcggcggccgtctggtcggtgcgttcgcc
accggccggccgcagcgtgtcaccgtggtgactcgttcgcacggcgactacggcgcccgc
attctgttcgatgcatcgattcccgtgttgcccggtttggagcgcgttccggtcttcgaa
ttctga

DBGET integrated database retrieval system