KEGG   Rhodopseudomonas palustris CGA009: RPA2852Help
Entry
RPA2852           CDS       T00153                                 

Definition
(GenBank) putative sugar hydrolase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00520  Amino sugar and nucleotide sugar metabolism
rpa01100  Metabolic pathways
rpa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RPA2852
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    RPA2852
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RPA2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CAE28293
CyanoBase: RPA2852
CYORF: RPA2852
UniProt: Q6N5W8
Position
complement(3226153..3227178)
Genome map
AA seq 341 aa AA seqDB search
MAPRAFITGIAGLSLSDDERGFFRESRPWGFILFKRNVDNPVQVKALVDDLRGTVGSPDA
PVLIDQEGGRVQRLGPPHWPVYPPGAVFSTLYDIDPEAGLTAARLSARLIADDLAALGIT
VDCLPLADVPITGADAVIGDRAYGTSPDKVAAIARAVTDGLAQGGVLPVLKHIPGHGRAT
ADSHHLLPTVETSREELDRTDFAAFRPLADLPMAMTAHVVFSALDAAQPATTSATIIDRV
IRDSIGFQGLLMSDDVSMNALAGSIAERTRAIVAAGCDVVLHCNGKLDEMRQVVAETPEL
QGRALTRAEAALAARHAPQPFDRAAARAELDALIGRARVGA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcgcgctttcatcaccggtattgccggccttagcctcagcgacgatgagcgc
ggatttttccgcgaatctcgtccctggggcttcattctgttcaagcgcaatgtcgacaac
ccggtacaagtcaaagcgctggttgacgatttgcgtggaaccgtcggttccccggacgcg
ccggtcctgatcgatcaggagggcggccgggtgcagcggctcggaccgccgcattggccg
gtgtatccgccgggcgcggtgttctccacgctctacgacatcgatcccgaggccgggttg
accgccgcgcggctgagcgcccgtctgattgcggacgatcttgcagcgctcggcatcacc
gtcgactgcctgccgctggccgacgtgccgatcaccggggccgacgcggtgatcggcgac
cgtgcctacggcaccagcccggacaaggtcgcggcgatcgcccgcgccgttaccgacggc
ttggcgcaggggggcgtgctgccggtgctcaagcacattcccggtcatggccgcgccacc
gccgacagccatcatctcctgccgaccgtcgagacctcgcgcgaggaactcgaccgcacc
gacttcgccgcgttccggccgctcgcggatctgccgatggcgatgactgcacatgttgtg
tttagcgcgctcgatgccgcccaacccgcgaccacttctgcgacaatcatcgaccgggtg
attcgcgactcgatcgggttccaaggattgctgatgagcgacgacgtctcgatgaacgcg
ctggccggcagcattgccgagcgcacccgcgcgatcgtcgcggcggggtgcgacgtcgtc
ctgcattgcaacggcaagctcgacgagatgcgccaggtggtggccgagactccggagctt
cagggcagggcgctgacacgcgccgaggcggcgctggccgcccgccatgccccacagccg
ttcgaccgcgctgcggcgcgggccgaactcgacgcattgatcggccgcgcaagggtgggc
gcatga

DBGET integrated database retrieval system