KEGG   Rhodopseudomonas palustris CGA009: RPA2888Help
Entry
RPA2888           CDS       T00153                                 

Gene name
cbbJ, tpi, tim
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00010  Glycolysis / Gluconeogenesis
rpa00051  Fructose and mannose metabolism
rpa00562  Inositol phosphate metabolism
rpa00710  Carbon fixation in photosynthetic organisms
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
rpa01230  Biosynthesis of amino acids
Module
rpa_M00002  Glycolysis, core module involving three-carbon compounds
rpa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA2888 (cbbJ)
   00051 Fructose and mannose metabolism
    RPA2888 (cbbJ)
   00562 Inositol phosphate metabolism
    RPA2888 (cbbJ)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPA2888 (cbbJ)
Enzymes [BR:rpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RPA2888 (cbbJ)
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RPA2888 (cbbJ)
  Exosomal proteins of bladder cancer cells
   RPA2888 (cbbJ)
  Exosomal proteins of melanoma cells
   RPA2888 (cbbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAE28329
CyanoBase: RPA2888
CYORF: RPA2888
UniProt: Q6N5T2
Position
complement(3265005..3265841)
Genome map
AA seq 278 aa AA seqDB search
MSLAIGSASGTLQPFIARVLMPVPAVRPLIAGNWKMNGLKDSVAELDAMLKGAAELPQGI
DLLVCPPATLVASFAARVAEAQAGKALPFSIGGQDCHANASGAHTGDIAAEMLADAGAAA
IIVGHSERRADHAENDAIVRAKAQAVWRAGLVAIVCVGETQGERDAGHTLDVVAGMLAGS
LPDGATAANLVVAYEPVWAIGTGRTPTAADVEEVHGFIRKTLSDRFGAAGETMRILYGGS
VKPSNARELLAVPHVNGALIGGASLKASDFLAIAAGCP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgagtctcgcaatcggctctgctagcggaacgcttcaaccctttattgcgagagtgctc
atgccggtccccgccgttcgtcctctgattgctggaaactggaagatgaacggcctgaag
gattcggtggccgagctcgatgcgatgctgaaaggcgccgcggaactgccgcagggcatc
gatctgttggtctgcccgccggcgacgctggtggcgagcttcgcggcgcgagtcgcggaa
gcccaggccggcaaggcactgccgttctcgatcggcggccaggattgccacgccaacgcc
tctggcgcccacaccggcgatatcgccgccgagatgctggccgatgccggcgctgcggca
atcatcgtcggccattccgaacgccgcgccgaccatgccgaaaacgacgcgatcgtccgc
gccaaggcgcaggcggtgtggcgcgccgggctggtggcgatcgtctgcgtcggcgagact
cagggcgagcgcgacgctggccacaccctcgatgtggtcgccggcatgttggccggctcg
ctgccggacggcgcgaccgcggcgaatctggtggtggcttacgagccggtctgggcgatc
ggcacgggacggaccccgaccgcggccgatgtcgaggaagttcatggctttattcgcaag
actttgagcgatcggttcggcgctgcgggcgagacgatgcgaatcctctacggcggctcg
gtgaagccctcgaacgcccgcgaattgctggcggtgccgcacgtcaacggcgcgctgatc
ggcggcgccagcctgaaggcgtccgatttccttgcgattgcggcgggctgcccctaa

DBGET integrated database retrieval system