KEGG   Rhodopseudomonas palustris CGA009: RPA2888Help
Entry
RPA2888           CDS       T00153                                 

Gene name
cbbJ
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPA2888 (cbbJ)
   01230 Biosynthesis of amino acids
    RPA2888 (cbbJ)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA2888 (cbbJ)
   00051 Fructose and mannose metabolism
    RPA2888 (cbbJ)
   00562 Inositol phosphate metabolism
    RPA2888 (cbbJ)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPA2888 (cbbJ)
Enzymes [BR:rpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RPA2888 (cbbJ)
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RPA2888 (cbbJ)
  Exosomal proteins of bladder cancer cells
   RPA2888 (cbbJ)
  Exosomal proteins of melanoma cells
   RPA2888 (cbbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3265005..3265841)
Genome map
AA seq 278 aa AA seqDB search
MSLAIGSASGTLQPFIARVLMPVPAVRPLIAGNWKMNGLKDSVAELDAMLKGAAELPQGI
DLLVCPPATLVASFAARVAEAQAGKALPFSIGGQDCHANASGAHTGDIAAEMLADAGAAA
IIVGHSERRADHAENDAIVRAKAQAVWRAGLVAIVCVGETQGERDAGHTLDVVAGMLAGS
LPDGATAANLVVAYEPVWAIGTGRTPTAADVEEVHGFIRKTLSDRFGAAGETMRILYGGS
VKPSNARELLAVPHVNGALIGGASLKASDFLAIAAGCP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgagtctcgcaatcggctctgctagcggaacgcttcaaccctttattgcgagagtgctc
atgccggtccccgccgttcgtcctctgattgctggaaactggaagatgaacggcctgaag
gattcggtggccgagctcgatgcgatgctgaaaggcgccgcggaactgccgcagggcatc
gatctgttggtctgcccgccggcgacgctggtggcgagcttcgcggcgcgagtcgcggaa
gcccaggccggcaaggcactgccgttctcgatcggcggccaggattgccacgccaacgcc
tctggcgcccacaccggcgatatcgccgccgagatgctggccgatgccggcgctgcggca
atcatcgtcggccattccgaacgccgcgccgaccatgccgaaaacgacgcgatcgtccgc
gccaaggcgcaggcggtgtggcgcgccgggctggtggcgatcgtctgcgtcggcgagact
cagggcgagcgcgacgctggccacaccctcgatgtggtcgccggcatgttggccggctcg
ctgccggacggcgcgaccgcggcgaatctggtggtggcttacgagccggtctgggcgatc
ggcacgggacggaccccgaccgcggccgatgtcgaggaagttcatggctttattcgcaag
actttgagcgatcggttcggcgctgcgggcgagacgatgcgaatcctctacggcggctcg
gtgaagccctcgaacgcccgcgaattgctggcggtgccgcacgtcaacggcgcgctgatc
ggcggcgccagcctgaaggcgtccgatttccttgcgattgcggcgggctgcccctaa

DBGET integrated database retrieval system