KEGG   Rhodopseudomonas palustris CGA009: RPA2891Help
Entry
RPA2891           CDS       T00153                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01130  Biosynthesis of antibiotics
rpa01230  Biosynthesis of amino acids
Module
rpa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPA2891 (trpC)
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RPA2891 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAE28332
CyanoBase: RPA2891
CYORF: RPA2891
UniProt: Q6N5S9
Position
3269058..3269921
Genome map
AA seq 287 aa AA seqDB search
MAGTSSAMTEYKRSFTRTGRAIVSDILTKIEAYKREEIAAAKRERPLAAIEAIAREASPP
RGFVKALRAKHAAGDYGLIAEIKKASPSKGLIRADFDPPALARAYEAGGAACLSVLTDTP
SFQGSLDYLVAARAAVSLPALRKDFMYDTYQVVEARAHGADCILIIMAALDDAEAKDIED
AAFDLGMDVLLEVHDAPELERALKLRSPMVGVNNRNLRSFEVTLATSEALAPLIPKDRLM
VGESGIFTPADLARLARVGMSTFLVGESLMRQQDVTAATRALLARAA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggccgggacaagctcggccatgacggagtacaaacgcagcttcactcgaactggacga
gccatcgtgtccgacatcctgaccaagatcgaagcctacaagcgcgaggagatcgcggcc
gccaagcgcgagcgcccgcttgcggcgatcgaggcgatcgcccgtgaagcatcgccgccg
cgcggcttcgtcaaggcgctgcgcgccaaacatgcggccggcgactacgggctgattgcc
gagatcaagaaggcctcgccgtcgaagggcctgatccgcgccgacttcgatccaccggcg
ctggctcgcgcctatgaggccggcggcgcggcgtgcctgtcggtgttgaccgatacgccg
tcgttccagggcagcctcgattatctcgtcgccgcgcgcgcggcggtgtcgctgccggcg
ctgcgcaaggatttcatgtacgatacctatcaggtggtcgaagcgcgcgctcacggcgcc
gactgcatcctgatcatcatggcggcgctcgatgacgccgaggccaaggacatagaggac
gccgcgttcgacctcggcatggacgtgctgctcgaagtgcacgatgcccccgaactcgag
cgcgcgctgaagctgaggtcgccgatggtcggcgtcaacaatcgtaatctgcgtagcttc
gaggtgacgctggcaaccagcgaggcgctggcgccgctgatcccgaaggaccgcctgatg
gtcggcgagagcggcatcttcacgcccgccgacctcgcccgcctcgctcgcgtcggcatg
tcgaccttcctggtcggcgaaagcctgatgcggcagcaagacgtcaccgccgccacccgc
gcgctgctggcgcgtgcggcctga

DBGET integrated database retrieval system