KEGG   Rhodopseudomonas palustris CGA009: RPA3316Help
Entry
RPA3316           CDS       T00153                                 

Definition
chemotaxis cheB/cheR fusion protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rpa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3740366..3743506
Genome map
AA seq 1046 aa AA seqDB search
MSVGKSGQETGASMVSPRRRPPSLVVGIGASAGGLAAFKTFFDNMPADTGMAFVLVQHLD
PDHKSLLVELLRPHSAMPVVEAQDHDPLAPNQVYVIPPNATLSLEGDVLRVATPSPAREY
RRPIDTFFASLAESQEDCAVGIILSGVGSDGSLGIKAIKEHGGFTLAQAEFDDTAMTGMP
SSAAATGLVDRVASVESLPTKLLEHQAYLTKVEEQKGADGAREDVRGSLSAITAVLRRRL
KHDFSGYKQNTLIRRIQRRMQVLQIESVTAYAEHLRKEPSEGDALFRELLIGVTQFFRDE
DAFDSLKANFLPSLFTGRDADDPIRVWVAGCATGEEAYSIAIMLQELLGSHQHEAAVTIF
ATDIDPQAVAFARAARFRRIDGLSQERLQRWFVKDGDDYVPTHVIREMCVFSEHNLVRDP
PFSRIDLITCRNVLIYMENDFQHRVMQTFHYALRPGGYLFIGPSESISRETGLFSIVDKK
HRILQRRDGARASLPHFVPQAGAISSPQLPANRIEDQIDKSARRVMAKHSPAYFVVDRNH
NIVRFSGGETGRYLEPSEGNASLDLFANLARSLRTQVRRAVETAFSSGRAVEEENLRLEG
KPPVDLVVEPIIEVGHPPSLVVVAFRTTSQTRDLPQEAEISPANRRELEAIQQEFRALQI
QHRATSEELESQIENMKSVTEEFQSVNEELQSSNEELETAKEEMQSVNEELQTINSELHG
KNELLLQANNDLQNLLDNTQIATIFLDDDLTVRNFTPAAREVFSLRDGDRGRPVTEITSL
LSYDKLCEDVRTVQRTLGVVESQLDLEDESATYIMRIRPYRTVANVISGVVITFSNITEQ
KQQHDHLQVLMGELQHRTNNVFAVILAIARQTVRNSASLETFEQQFGTRLLALAQANALL
VDQEWKGVSLEKLIEAQLAPFIGGDSTRLELVGPPVTMAGATIQTIGLALHELATNASKY
GSLSVPGGKVVVSWSFDEGGTSPESFRLEWREQDGPPVKPSDRKGFGHFVTKQMVTRSLN
AKVDVDLAPEGLRWSMQMPANEARSG
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgggaagtcaggccaagagaccggtgcgtctatggtttcgccccgtcggcgc
ccgccttccctggtggtcggcattggtgcatcggcgggcgggctcgccgccttcaagacg
ttctttgacaatatgccggccgacaccggtatggcgttcgtgctggttcagcacctcgat
cccgatcacaagagtctgctggtcgagctgttgcgaccgcattcggccatgccggtggtc
gaggcgcaggaccacgatcctctggcgcccaaccaggtttatgtgatcccgcccaatgca
acgctgtctctcgagggagacgttctacgcgttgcgacgccctcgcccgcgcgggagtat
cgtcgtccgatcgacacgttcttcgcgtcgctcgcggagagccaggaggattgcgcagtc
ggcatcatcctgtccggtgtcggcagcgacgggtcgctcggcatcaaggccatcaaggag
catggcgggtttacgctggctcaggcggagttcgacgataccgcaatgacgggaatgccg
agcagtgccgcggccacgggactggtcgatcgcgtcgcctcggtcgagagcctgccgacc
aaattgctcgagcatcaagcctatctgaccaaggtcgaggagcagaaaggggcagatggc
gcacgcgaggacgtccgcggcagcttgagcgccattacggcggtgctgcgcagacggctc
aagcacgatttcagcggctacaagcaaaacaccctcatccgccgaattcagcgccggatg
caggttcttcagatcgagtcggtcaccgcttatgcagagcatctgcgcaaggagccttcc
gaaggcgacgctctgtttcgcgagctgctgatcggcgtcacccagttcttccgtgacgaa
gacgcattcgactccctgaaggccaatttcctgccgtcgctgttcaccgggcgagatgcg
gacgatccgatccgggtctgggtggcaggctgcgccaccggcgaggaagcgtattcgatt
gcgatcatgctgcaggaactcctcggctcccatcaacacgaggctgctgtcaccattttc
gccaccgatatcgatccgcaggccgtcgcgttcgcccgcgccgcgcggttccgccgaatt
gacggcctatcgcaggagcggcttcaacgctggttcgtgaaagacggcgacgactacgtt
ccgactcatgtcatccgggagatgtgcgttttctccgagcacaatctggtcagagatcct
ccgttctccaggatcgacctgattacatgccgcaacgtcctgatctatatggagaacgat
tttcagcaccgggtgatgcagacgttccattatgcactgcggcccggcggctacctgttc
atcggtccgtccgaaagcatcagccgcgaaacaggattgttcagcatcgtcgacaaaaag
caccgcatcctgcaacgccgagacggcgccagagcctcgctgccgcacttcgtgccgcag
gcaggggccatttcatctccccaactgccggccaaccggatcgaagaccaaatcgacaag
agcgcgcgccgcgtcatggcgaagcactctccggcttatttcgttgtcgatcgcaaccac
aacatcgtccgattttccggcggcgagaccgggcgctatctcgagccttcggaaggcaac
gccagcctcgacctgttcgccaatctggcgagaagcctcagaacgcaggtccgtcgcgct
gtcgagaccgccttctcgtcggggcgcgcggttgaagaagaaaacctgagactcgaaggc
aagccgccggtcgacctcgtcgtcgaaccgattatcgaggtcggacatccgccgagcttg
gtagtggtcgccttccgaaccacctctcagacacgcgacctgccgcaagaggccgagata
tctccggcgaaccggcgcgaactcgaggcgattcagcaggaatttcgcgccttacagatc
caacatcgggcgaccagcgaggaactggaaagccagatcgaaaatatgaaatcggtgacc
gaggagttccagtcggtcaacgaggagcttcaatcgtccaatgaggagctcgagaccgcc
aaggaggagatgcagtcggtcaacgaggaactgcagaccatcaacagcgaactgcacggc
aagaacgagctgctgctgcaggccaacaacgatcttcagaacctgctcgacaacacgcag
atcgccaccatctttctcgacgacgatctcacggtccgaaacttcacgccggcggcgcgc
gaagtgttttcactgcgcgacggcgaccgcggccggccggtgacggagatcacctccctg
ctgtcctacgacaagctgtgcgaagacgtcagaacggttcaacgcactctcggtgtcgtg
gaaagccagctcgatctcgaggacgagagcgcgacctatatcatgcggatcaggccctac
cgcacggtcgccaacgtcatctcgggagtcgtgatcacgttcagcaacatcacagagcag
aagcagcagcacgaccaccttcaagtcttgatgggggagctccagcatcgcaccaacaac
gtctttgcggtcattctcgcgatcgcacgacagacagtgcgcaacagcgcatcgttggaa
acattcgaacagcaattcggcacgcgactgctggcgctggcgcaagccaacgcgctgctc
gtcgaccaggagtggaagggcgtttcactggagaaactgatcgaagcgcagctggcgccg
tttatcggtggcgactccactcggctcgagttggtcggcccccccgtgacgatggccggc
gccaccatccagacgatcgggctcgcgctgcacgagcttgcgaccaatgcatccaaatac
ggttcactatcggtgccgggcggcaaggtggtcgtaagctggagcttcgacgagggcggg
acgtcccctgagtcgttccgactggagtggcgagaacaggatggtccgccggtcaagccg
agcgaccgcaaaggcttcggtcacttcgtcacaaagcagatggtcacacgctcactcaac
gcgaaggtggacgtcgacctcgctcccgaaggactgcgatggagcatgcagatgccggcg
aatgaagcccgcagcggatag

DBGET integrated database retrieval system