KEGG   Rhodopseudomonas palustris CGA009: RPA3321Help
Entry
RPA3321           CDS       T00153                                 

Gene name
algC
Definition
(GenBank) possible phosphomannomutase AlgC
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00010  Glycolysis / Gluconeogenesis
rpa00030  Pentose phosphate pathway
rpa00051  Fructose and mannose metabolism
rpa00052  Galactose metabolism
rpa00230  Purine metabolism
rpa00500  Starch and sucrose metabolism
rpa00520  Amino sugar and nucleotide sugar metabolism
rpa00521  Streptomycin biosynthesis
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA3321 (algC)
   00030 Pentose phosphate pathway
    RPA3321 (algC)
   00051 Fructose and mannose metabolism
    RPA3321 (algC)
   00052 Galactose metabolism
    RPA3321 (algC)
   00500 Starch and sucrose metabolism
    RPA3321 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    RPA3321 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    RPA3321 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPA3321 (algC)
Enzymes [BR:rpa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RPA3321 (algC)
    5.4.2.8  phosphomannomutase
     RPA3321 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAE28762
CyanoBase: RPA3321
CYORF: RPA3321
UniProt: Q6N4L6
Position
complement(3746647..3748143)
Genome map
AA seq 498 aa AA seqDB search
MFPTPQPLLTANTYAYESEPMVKPTGFREYDARWLFGQEINLMGVQALGMGLGTLIAELG
RPQEIVTGHDFRGYSASIKYALIAGLMASGCKVHDIGLAVTPMAYFAQFELDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMNRLKEIVLGAAFKQGAGSYVFHPNFPARYIADLT
KHAKLKRKLKVVVACGNGTAGAFAPQVMEAIGCEVIPLDTELDHTFPKYNPNPEDMEMLH
AIRDAVLQHKADLGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSAIHPNARFVVDV
KSTGLFATDPVLQQQGAQTEYWKTGHSYMKRRTNELNALAGFEKSGHFFFNAPLGRGYDD
GLVSAIAICEMLARAPGKSMSDLKNALPKTWSSPTMSPHCADEVKYRVIDQVVKHFEAAK
TNGDLVAGQPIRDLVTVNGVRVTCEDGSWGLVRASSNKPELVVVVESPVSEQRMHDMFEA
VNVVLRQHPEVGAYNQTI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgacgccgcagccgcttctgacggccaacacctacgcctacgaatccgagccg
atggtgaagcccaccggttttcgcgagtacgacgcgcgctggctgttcggccaggagatc
aacctgatgggggtgcaggcgctcggcatggggctcggcacgctgatcgccgagctcggc
cggccgcaggagatcgtcaccgggcatgatttccgcggctattcggcctcgatcaaatac
gcgctgatcgccggcctgatggcgtcgggctgcaaggtccacgacatcgggctcgcagtg
acgccgatggcgtatttcgcgcagttcgagctcgacgtgccgtgcgtcgcgatggtcacc
gcctcgcacaacgacaacggctggaccggcgtcaagatgggcgccaaccggccgctgacc
ttcggccccgacgagatgaaccggctgaaggagatcgtgctcggcgcggcgttcaagcag
ggcgccggctcttatgtgtttcatccgaactttccggcccgctacatcgccgacctcacc
aagcacgctaagctgaagcgtaagctcaaggtggtggtcgcctgcggcaacggcaccgcc
ggcgcgttcgcgccgcaggtgatggaagcgatcggctgcgaggtgatcccgctcgacacc
gagcttgaccacaccttcccgaagtacaatcccaatcccgaagacatggagatgctgcac
gcgatccgcgacgcggtgctgcagcataaggccgatctcggtctcggttttgacggcgac
ggcgaccgctgcggcgtggtcgacgacaccggcgaggagatcttcgccgacaaggtcggg
gtgatgctggcgcgcgacatgtcggcgatccatccgaacgcgcgctttgtcgtcgacgtc
aaatcgaccggcctgttcgcgaccgatccggtgctgcaacagcagggcgcccagaccgaa
tactggaagaccggccactcctacatgaagcggcgcaccaatgagctgaacgcgctcgcg
ggcttcgagaagtccggccacttcttcttcaacgccccgctcggccgcggctatgacgac
gggttggtgtcggcgatcgcgatctgcgagatgctcgcccgcgcacccggcaagtcgatg
tcggatctgaagaacgcgctgccgaagacctggtcgtcgccgacgatgtcgccgcattgc
gccgacgaggtgaagtaccgggtgatcgatcaggtggtgaagcacttcgaagccgccaag
accaatggcgacctcgtcgccggccagccgatccgcgatctggtcaccgtcaacggcgtc
cgcgtcacctgcgaagacggcagctggggcctggtccgcgcctcctccaacaaacccgag
ctggtggttgtggtcgaaagtccggtgtcggagcagcggatgcacgacatgttcgaagcg
gtgaacgtcgtactgcgccagcatcccgaagtcggcgcgtataaccaaacgatctga

DBGET integrated database retrieval system