KEGG   Rhodopseudomonas palustris CGA009: RPA3321Help
Entry
RPA3321           CDS       T00153                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA3321 (algC)
   00030 Pentose phosphate pathway
    RPA3321 (algC)
   00051 Fructose and mannose metabolism
    RPA3321 (algC)
   00052 Galactose metabolism
    RPA3321 (algC)
   00500 Starch and sucrose metabolism
    RPA3321 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    RPA3321 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    RPA3321 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPA3321 (algC)
Enzymes [BR:rpa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RPA3321 (algC)
    5.4.2.8  phosphomannomutase
     RPA3321 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3746647..3748143)
Genome map
AA seq 498 aa AA seqDB search
MFPTPQPLLTANTYAYESEPMVKPTGFREYDARWLFGQEINLMGVQALGMGLGTLIAELG
RPQEIVTGHDFRGYSASIKYALIAGLMASGCKVHDIGLAVTPMAYFAQFELDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMNRLKEIVLGAAFKQGAGSYVFHPNFPARYIADLT
KHAKLKRKLKVVVACGNGTAGAFAPQVMEAIGCEVIPLDTELDHTFPKYNPNPEDMEMLH
AIRDAVLQHKADLGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDMSAIHPNARFVVDV
KSTGLFATDPVLQQQGAQTEYWKTGHSYMKRRTNELNALAGFEKSGHFFFNAPLGRGYDD
GLVSAIAICEMLARAPGKSMSDLKNALPKTWSSPTMSPHCADEVKYRVIDQVVKHFEAAK
TNGDLVAGQPIRDLVTVNGVRVTCEDGSWGLVRASSNKPELVVVVESPVSEQRMHDMFEA
VNVVLRQHPEVGAYNQTI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgacgccgcagccgcttctgacggccaacacctacgcctacgaatccgagccg
atggtgaagcccaccggttttcgcgagtacgacgcgcgctggctgttcggccaggagatc
aacctgatgggggtgcaggcgctcggcatggggctcggcacgctgatcgccgagctcggc
cggccgcaggagatcgtcaccgggcatgatttccgcggctattcggcctcgatcaaatac
gcgctgatcgccggcctgatggcgtcgggctgcaaggtccacgacatcgggctcgcagtg
acgccgatggcgtatttcgcgcagttcgagctcgacgtgccgtgcgtcgcgatggtcacc
gcctcgcacaacgacaacggctggaccggcgtcaagatgggcgccaaccggccgctgacc
ttcggccccgacgagatgaaccggctgaaggagatcgtgctcggcgcggcgttcaagcag
ggcgccggctcttatgtgtttcatccgaactttccggcccgctacatcgccgacctcacc
aagcacgctaagctgaagcgtaagctcaaggtggtggtcgcctgcggcaacggcaccgcc
ggcgcgttcgcgccgcaggtgatggaagcgatcggctgcgaggtgatcccgctcgacacc
gagcttgaccacaccttcccgaagtacaatcccaatcccgaagacatggagatgctgcac
gcgatccgcgacgcggtgctgcagcataaggccgatctcggtctcggttttgacggcgac
ggcgaccgctgcggcgtggtcgacgacaccggcgaggagatcttcgccgacaaggtcggg
gtgatgctggcgcgcgacatgtcggcgatccatccgaacgcgcgctttgtcgtcgacgtc
aaatcgaccggcctgttcgcgaccgatccggtgctgcaacagcagggcgcccagaccgaa
tactggaagaccggccactcctacatgaagcggcgcaccaatgagctgaacgcgctcgcg
ggcttcgagaagtccggccacttcttcttcaacgccccgctcggccgcggctatgacgac
gggttggtgtcggcgatcgcgatctgcgagatgctcgcccgcgcacccggcaagtcgatg
tcggatctgaagaacgcgctgccgaagacctggtcgtcgccgacgatgtcgccgcattgc
gccgacgaggtgaagtaccgggtgatcgatcaggtggtgaagcacttcgaagccgccaag
accaatggcgacctcgtcgccggccagccgatccgcgatctggtcaccgtcaacggcgtc
cgcgtcacctgcgaagacggcagctggggcctggtccgcgcctcctccaacaaacccgag
ctggtggttgtggtcgaaagtccggtgtcggagcagcggatgcacgacatgttcgaagcg
gtgaacgtcgtactgcgccagcatcccgaagtcggcgcgtataaccaaacgatctga

DBGET integrated database retrieval system