KEGG   Rhodopseudomonas palustris CGA009: RPA3445Help
Entry
RPA3445           CDS       T00153                                 

Definition
(GenBank) probable acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00010  Glycolysis / Gluconeogenesis
rpa00620  Pyruvate metabolism
rpa00640  Propanoate metabolism
rpa00680  Methane metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA3445
   00620 Pyruvate metabolism
    RPA3445
   00640 Propanoate metabolism
    RPA3445
  Energy metabolism
   00680 Methane metabolism
    RPA3445
Enzymes [BR:rpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RPA3445
Lipid biosynthesis proteins [BR:rpa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RPA3445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_S6e
Motif
Other DBs
NCBI-ProteinID: CAE28886
CyanoBase: RPA3445
CYORF: RPA3445
UniProt: Q6N494
Position
complement(3886503..3888224)
Genome map
AA seq 573 aa AA seqDB search
MTTFQQARAFLLQHRTDYDKAVAGFRWPDPAPFNWALDWFDAELAVHPDSRDRAALWIVD
GASGSEVKPTFAQLSKRSNQVANYLRAKGLKRGDHLLLLLGNVVPLWETMLAAIKLGLVT
IPATTLLTPEELRDRLDRGRAKAVVAAPDQVAKFAGLGGDDLLRIVVGDAQDGWLAYAET
AQQPDAFTPDGPTKADDPMLLYFTSGTTAKPKLVRHSQRSYPVGALSTMFWLGLQPGDVH
LNISSPGWAKHAWSCFFAPWNAGATVFVVNQPRFDAKSLLATIGRCGVTTLCAPPTVWRM
FIQEKLADYHVSLREVCGAGEPLNPEVIDQVKAAWGLTIRDGYGQTETTAMVGNSPGQKV
KIGSMGRPLPGYVVKITDADGHPAKEGEITLALGDARPAGLMQGYQGEGGKLTGADGEVY
RSGDVAFADEDGYLTFVGRTDDVFKSSDYRISPFELESVLLEHDLVAEAAVVPSPDPIKL
AIPKAYVLLTANAERSRDTALSIFKHMQGRLAPFKRIRKLEIVSELPKTISGKIRRVQLR
RIEHDNDQADSLRGLAFSEEDFPELKAAPAKDG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgttccagcaagctcgtgcctttctgctccaacaccgcaccgactacgacaag
gccgtcgccggcttccgctggcctgatccggcgccgttcaactgggcgctcgactggttc
gacgctgaactcgccgtccatcccgacagccgcgaccgcgcggcgctgtggatcgtcgac
ggcgccagcggcagcgaggtcaagccgacctttgcgcagctctccaagcgctccaaccag
gtcgccaactatctgcgcgccaaggggctgaagcgtggcgatcatctgctgctgctgctc
ggcaacgtcgtgccgttgtgggagacgatgctggcggcgatcaagctcggcctcgtcacc
attccggcgaccacgctgctcaccccggaggaattgcgcgaccggctcgaccgcggccgc
gccaaggcggtggtggcggcgccggatcaggtcgccaagtttgccggcctcggcggcgac
gatctgctccgcatcgtcgtcggcgacgcacaggacggctggctcgcttacgccgagacc
gcacagcaacccgatgcgttcacgccggacggcccgacgaaggccgacgatccgatgctg
ctgtatttcacctccggcaccaccgcgaagccgaagctggtgcggcacagccagcgctcc
tatccggtcggcgcgctgtcgacgatgttctggcttgggctgcagcccggtgacgtgcac
ctgaacatctcctcgccgggctgggccaagcatgcctggagctgcttctttgcgccgtgg
aatgccggcgccaccgtgttcgtcgtcaaccagccgcggttcgatgccaagagcctgctc
gccaccatcggccgctgcggcgtcaccacgctgtgcgcgccgccgacggtgtggcggatg
ttcatccaggagaagctggcggactatcatgtcagcctgcgagaggtctgcggcgccggc
gagccgctcaatccggaagtgatcgatcaggtcaaagctgcgtgggggcttaccattcgc
gacggctacggccagaccgagaccaccgcgatggtcggcaattcaccgggccagaaggtg
aagatcggctcgatggggcggcctctgccgggctacgtcgtcaagatcaccgatgccgac
ggccatccggccaaggagggcgagatcacgctggcgctcggtgacgcgcgccccgccggg
ctgatgcagggttatcagggcgagggcggcaagctcacgggcgccgacggcgaggtgtat
cgctccggcgatgtcgccttcgccgacgaggacggctatctgactttcgtcggccgcacc
gacgacgtgttcaaatcctcggactaccggatctcgccgttcgaactcgagagtgtgctg
ctggagcacgacctcgtggctgaagccgcggtggtgccgagcccggatccgatcaagctg
gcgatcccgaaagcctatgtgctgctcaccgcgaacgctgagcgctcgcgcgacaccgcg
ctgtcgatcttcaagcacatgcagggccggctggcgccgttcaagcggatccgcaagctg
gagatcgtcagcgagctgccgaaaacgatctccggcaagatccgccgcgtccagctccgc
cgcatcgagcacgacaacgatcaggccgatagcttgcgcgggctcgcgttctccgaagag
gacttcccggagctgaaggccgcgccggcgaaggatggttag

DBGET integrated database retrieval system