KEGG   Rhodopseudomonas palustris CGA009: RPA3535Help
Entry
RPA3535           CDS       T00153                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rpa00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rpa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3998541..3999998)
Genome map
AA seq 485 aa AA seqDB search
MKLRDIFSAEADIAAPAADLTIGGLAVDSRAVKPGDLFFALAGAKTDGARFVAAAVAAGA
VAVAGEHRPEGDLSVPFVQLSNARLALAQAAARFYPRQPEVIAAVTGTSGKTSVAAFTRQ
IWQRLGHAAASIGTIGLVTPTRSVYGSLTTPDPIALHRSLDEIAREGITHLALEASSHGL
DQFRLDGVRVAAGGFTNLSRDHMDYHPTVAHYLNAKLRLFRNLVQDGGAAVISADHDCSA
QVIEAAGARGLRLITIGRNGDPGAGIKLIDAAVEGFAQQLTVEHAGKRHRIKLPLVGEFQ
IENALVAAGLVIGTGGDAAASFAALEHLEGAPGRLDLVGARNGAPVFVDYAHKPDALAKT
LQALRPYAKRKLVVVFGAGGDRDSGKRPLMGAIAAENADVVIITDDNPRSEDPATIRAAI
LAAAPGAREIGDRAEAIRTAIGELQPGDALVIAGKGHETGQIVGDRVLHFSDHDAAKAAL
SASAA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcgcgacatcttcagcgccgaggccgacatcgccgcgccagcggccgatctc
accatcggcgggctcgccgtcgacagccgcgcggtgaagccgggcgacctgttcttcgcg
ctcgccggggccaagaccgacggggcgcggttcgtcgcggcggcggttgcggccggggcg
gtggcggttgcgggcgagcaccggccggagggcgacctctcggtgccgttcgtgcagctg
tccaatgcgcgcctggcgctggcacaggccgcggcgcggttctacccgcgccagcccgag
gtgatcgcggccgtcactggcaccagtggcaagacctcggtcgcggccttcacccggcaa
atctggcagcggctcggccatgccgccgccagcatcgggaccatcggtctcgtcaccccg
acgcgcagcgtgtacggctcgctgaccacgccggacccgatcgcgctgcaccgctcgctc
gacgagatcgcgcgcgagggcatcacccatctggcgctggaagcctcgtcgcacgggctc
gatcagttccggctcgacggcgttcgcgtcgcggcaggtggcttcactaatttgtcgcgc
gaccacatggattatcaccccaccgtcgcgcactatctcaatgccaagctgcggctgttc
cgcaatctggtgcaggacggcggcgcggcagtgatctccgccgatcacgactgttcggcc
caagtgatcgaagcggcgggcgcccgcggcctgcggctgatcacgatcggccgcaacggt
gatccgggcgcaggcatcaagctgatcgacgccgcggtcgaaggcttcgcgcaacagctc
acggtcgagcacgcggggaagcggcatcgcatcaaactgccgctggtcggcgaattccag
atcgagaacgcgctggtcgcggcaggtctggtgatcggcaccggcggcgacgcggcggcg
agcttcgccgcgctcgaacatcttgaaggtgcgccgggccggctcgatctggttggcgcc
cgcaacggcgcaccagtgttcgtcgactacgcgcacaagcccgatgcgctcgccaaaacc
ctgcaggcgctgcgtccctatgccaagcgcaagctggtcgtggtgttcggcgccggcggt
gatcgcgactccggcaagcggccgctgatgggcgcgatcgcggccgagaacgccgacgtg
gtgattatcaccgacgacaatccgcgcagtgaagatcccgccacgatccgcgccgccatt
cttgcggctgcgcccggcgcgcgcgagatcggcgaccgcgccgaggcgatccgcacagcg
atcggcgagctgcagccgggtgatgcgctggtgatcgccggcaagggccacgaaaccggg
cagatcgtgggcgaccgcgtgctgcatttcagcgaccacgacgccgcgaaagcggcgcta
tcagcgagcgccgcatga

DBGET integrated database retrieval system