KEGG   Rhodopseudomonas palustris CGA009: RPA3644Help
Entry
RPA3644           CDS       T00153                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme (glycogen branching enzyme)
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00500  Starch and sucrose metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
Module
rpa_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPA3644 (glgB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RPA3644 (glgB)
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPA3644 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CAE29085
CyanoBase: RPA3644
CYORF: RPA3644
UniProt: Q6N3P9
Position
4111821..4113971
Genome map
AA seq 716 aa AA seqDB search
MTVQLSDEAYAVVEGRHADPFRYLGAHPEDGGTMVRVLLPDAVAVEVIGDNGDVAPLDQA
HPAGLFVGPLPGASPRYTLRARFGDTTVELQDPYRFPPILSDFDLYLLGEGTDQRLYDKL
GAHPMELEGVAGVGFVVLAPNARRVSVVGDFNFWNPLRHQMRVRGSGYWELFVPGARAGD
HYKFDLAGPNGEQLPQKADPLAFAAELRPKTASIVVDATTLPRPRPAPENINALSAPMSI
YEVHLGSWRRKEGDQWLTYRELAEQLPAYVRDMGFTHVEFLPVSEHPFDGSWGYQPTGLY
APTSRFGSPEDFCALVDACHAAGIGVILDWVPGHFPDDPHGLGNFDGTALYEHANPMQGR
HLDWGTLIYNYGRTEVVNFLTANALFWLERYGIDGLRVDAVASMLYLDYSRPAGGWIPNK
FGGRENIEAIDFIRRFNTEVYGKFPHSTTAAEESTAWPQVSRPIEFGGLGFGYKWNMGWM
HDTLNYISKDPIHRKYHHGQILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDEWQR
FANLRAYYAFMFGHPGKKLLFMGSEFGQEREWSHDRSLDWHLLEYPKYSGIQALLRDLNK
LYRSLPALHQLDCDPFGFEWLITEDANRNLFAWMRKGNDTRARCLVIVNFSPNVYQDYRV
RVPFPGRWREVFNSDSAGYGGTNVGNGGEVRTLEGLVPELSLTIPPLAAIFLTPED
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcaattgagcgacgaagcctacgcagttgtcgaaggccgtcatgccgaccct
ttccgctatctcggcgcgcaccctgaggatggcggcaccatggtgcgcgtgctgctgccg
gatgccgttgcggtcgaggtgatcggcgacaatggcgacgttgcgccgctcgaccaggcg
catccggccggcctgttcgtcggacctctgcccggcgcttcgccgcgctacacgttgcgc
gcacggttcggcgacaccacggtcgagctgcaggacccctaccgcttcccgccgatcctc
agcgatttcgatctttacctgctcggcgaaggcaccgaccaacgactttacgacaagctt
ggcgcccatccgatggagctggaaggtgtcgccggcgtcggcttcgtggtgctggcgccg
aacgcgcgccgcgtcagcgtggtcggcgatttcaacttctggaatccgctgcgccaccag
atgcgggtgcgcggcagcggctattgggagttgtttgtcccgggcgcccgcgccggcgat
cactacaagttcgatctcgccggaccgaacggcgaacaactgccgcagaaggccgacccc
ttggcattcgccgccgagctgcggccgaagaccgcctcgatcgtggtcgacgccaccacg
ctgccacgaccacggccggcgccggagaacatcaacgcgctgtcggcgccgatgtcgatc
tacgaggtgcatctcggctcgtggcgccgcaaggaaggcgaccagtggctgacctatcgc
gaactcgccgagcaactgccggcctatgtccgcgacatgggctttacccacgtcgaattc
ctgcccgtcagcgagcatccgttcgacggctcgtggggctatcagccgaccgggctgtac
gcaccgacctcgcggttcggctcgcccgaagacttctgtgcgctggtcgacgcctgccat
gccgcgggcatcggcgtgatcctcgactgggtgccgggccatttcccggacgatccgcac
ggcctcggcaatttcgacggcaccgcgctctacgagcacgccaacccgatgcagggtcgg
catctcgactggggcacgctgatctacaattacgggcgaaccgaggtcgtcaatttcctc
accgcgaacgcgctgttctggctggagcgttacggaatcgacgggctgcgcgtcgatgcc
gtggcatcgatgctgtacctcgattacagccgcccggccggcggctggatcccgaacaaa
ttcggcggccgtgagaacatcgaggcgatcgacttcattcgccgcttcaacactgaagtg
tacggcaaattcccgcactccaccaccgcagcggaggaatccaccgcctggccgcaagtg
tcgcgcccgatcgaattcggcgggctcggattcggctacaagtggaacatggggtggatg
cacgatacgctgaactacatcagcaaggatccgattcaccgcaaatatcatcacggccag
atcctgttcggactgcactacgcgttctcggagaatttcattctgccgctgtcgcacgac
gaggtcgttcacggcaaacgctcgatcctcggccggatgccgggcgatgagtggcaacgc
tttgcgaatttgcgcgcctactatgcgttcatgttcggccatcccggcaagaagctgctg
ttcatgggcagcgagttcggccaggagcgcgagtggagccacgatcgctcgctcgactgg
catctgctggagtatccgaaatattccggcatccaggcgctgctgcgcgacctcaacaag
ctgtacaggtcgctgccggccctgcatcagctcgattgcgatccgttcggcttcgaatgg
ctgatcaccgaagacgccaaccgcaacctgttcgcctggatgcgcaagggcaacgatacc
cgcgcccgctgtctggtcatcgtcaacttctcaccgaacgtctaccaggactatcgcgtc
cgcgtgccgttccccggccgctggcgcgaagtgttcaattcggattcggccggctacggc
ggcaccaatgtcggcaatggcggcgaagtccgcaccctggagggtctggtgcctgagctc
agcctgacgatcccgccgctggccgcgatcttcctgacgccggaggattga

DBGET integrated database retrieval system