KEGG   Rhodopseudomonas palustris CGA009: RPA3646Help
Entry
RPA3646           CDS       T00153                                 

Definition
maltooligosyltrehalose trehalohydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPA3646
Enzymes [BR:rpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RPA3646
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPA3646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4116288..4118054
Genome map
AA seq 588 aa AA seqDB search
MTLRSFGPRLTGNGVEFRIWAPNAKRVDVVLDRPHPMRRDAMGWYTTHIDGIGAGARYRF
LIDGSLDVPDPASLFQPEDLAGPSEVIDHAAYQWRAKEWHGRPWAETVLLETHVGTFTPE
GSFRAMIDKLDHLVDTGITALELMPLADFPGTRNWGYDGVLWYAPDSAYGRPEDLKALID
EAHLRGLMVFLDVVYNHFGPEGNYLGQYAPGFFSDSHTPWGNGINYYVEQVRAFAIENAL
YWLDDYRFDGLRLDAVHAIPDQGEIPMLDELSREVGRLAAETGRYVHLVLENDDNTAAVL
DPVTHPPRGQYRAQWNDDYHHAWHVALTGETHGYYSDYANAPLAHLARALGSGFVFQGEP
SEHRGGQPRGEPSGDLVPLAFINFLQNHDQIGNRALGDRLESLVKPQAIEAALAVTLLAP
TVPMLFMGEEWGSQAPFPFFCDFQGDLAEAVRAGRRKEFAGAYKEYGDEVPDPLSKDAFD
SAVLDWHERDQGRGAARLALVKRLLAIRHREIVPRLDSSRFGDARITGDGLLKAFWRLTD
GATLELVANLSDDERDGGAPPAAGTILWGGDWNRIIPPWAVSWRLEHP
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccgcagtttcgggccgcgtctcaccggtaacggcgtcgaatttcgcatctgg
gcgccgaacgcgaaacgcgtcgatgtcgtgctcgaccgtccgcatccgatgcggcgcgac
gccatgggctggtacaccacccacatcgacggcatcggcgctggcgcacgctatcgcttc
ctgatcgacggcagcctcgatgtgccggacccggcctcgctgtttcagcccgaggatctg
gccggaccgagcgaagtgatcgaccacgccgcgtatcaatggcgcgccaaggaatggcac
ggacggccctgggccgaaaccgtgctgctcgaaacccatgtcggcaccttcacgcccgag
ggcagctttcgcgcgatgatcgacaagctcgaccatctggtcgacaccggcatcaccgcg
ctggaattgatgccgctcgccgatttccccggcacgcgcaattggggctacgacggcgtg
ctgtggtatgcgccggacagcgcctatggccgtcccgaggatctcaaggcgctgatcgac
gaggcgcatctgcgcggcctgatggtgttcctcgacgtcgtctataaccatttcggcccc
gaagggaattacctcggccaatacgcacccgggttcttctccgattcgcacacgccgtgg
ggcaacggcatcaactactacgtcgagcaggtccgcgccttcgcgatcgagaacgcgttg
tactggttggacgattatcgtttcgacgggctacggctcgacgcggtacatgcgatcccc
gatcagggcgaaatcccgatgctggacgagctgtcgcgcgaagtcggccggctcgccgcg
gagaccgggcgctacgtgcatctggtgctcgagaacgacgacaacaccgccgccgtgctc
gatccggtcacccatccgccgcgggggcaatatcgcgcgcaatggaacgacgactaccac
cacgcctggcacgtcgcgctgaccggcgagactcacggctactattcagattacgccaat
gcgccgctggcgcatcttgcccgcgcgctcggctccggcttcgtgtttcagggcgagccg
tcggaacatcgcggcggccagccgcgcggcgaaccgagcggagacctcgtgccgctcgcc
ttcatcaacttcctgcagaaccacgatcagatcggcaaccgcgcgcttggcgaccggctg
gaaagcctggttaagccgcaggcgatcgaagcggcgctcgccgtcacgctgctggcgccg
acggtgccgatgctgttcatgggcgaggaatggggatcgcaggcgccgttcccgttcttc
tgcgattttcaaggcgatcttgccgaagcggtgcgggccggacggcgcaaggaattcgcc
ggcgcctacaaagagtacggcgacgaggtccccgatccgctcagcaaggacgcgttcgac
agcgccgtgctcgattggcacgagcgcgaccagggccgcggcgccgcgcgtctggccctc
gtcaagcgcctgctcgccatccgccaccgcgagatcgtgccgcggcttgacagctcgcgg
ttcggcgacgctcggatcaccggcgatggcctgctgaaggcgttctggcggctcaccgac
ggtgcgacgctcgaactcgtcgccaatctgtcggacgacgaacgtgacggcggggcgcca
cccgcggcgggaactattctatggggcggcgattggaaccggatcattccgccttgggcg
gtgtcctggcgcctcgagcatccgtaa

DBGET integrated database retrieval system