KEGG   Rhodopseudomonas palustris CGA009: RPA3646Help
Entry
RPA3646           CDS       T00153                                 

Definition
(GenBank) putative maltooligosyltrehalose trehalohydrolase (EC:2.4.1.18)
  KO
K01236  
maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPA3646
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     RPA3646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4116288..4118054
Genome map
AA seq 588 aa AA seqDB search
MTLRSFGPRLTGNGVEFRIWAPNAKRVDVVLDRPHPMRRDAMGWYTTHIDGIGAGARYRF
LIDGSLDVPDPASLFQPEDLAGPSEVIDHAAYQWRAKEWHGRPWAETVLLETHVGTFTPE
GSFRAMIDKLDHLVDTGITALELMPLADFPGTRNWGYDGVLWYAPDSAYGRPEDLKALID
EAHLRGLMVFLDVVYNHFGPEGNYLGQYAPGFFSDSHTPWGNGINYYVEQVRAFAIENAL
YWLDDYRFDGLRLDAVHAIPDQGEIPMLDELSREVGRLAAETGRYVHLVLENDDNTAAVL
DPVTHPPRGQYRAQWNDDYHHAWHVALTGETHGYYSDYANAPLAHLARALGSGFVFQGEP
SEHRGGQPRGEPSGDLVPLAFINFLQNHDQIGNRALGDRLESLVKPQAIEAALAVTLLAP
TVPMLFMGEEWGSQAPFPFFCDFQGDLAEAVRAGRRKEFAGAYKEYGDEVPDPLSKDAFD
SAVLDWHERDQGRGAARLALVKRLLAIRHREIVPRLDSSRFGDARITGDGLLKAFWRLTD
GATLELVANLSDDERDGGAPPAAGTILWGGDWNRIIPPWAVSWRLEHP
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccgcagtttcgggccgcgtctcaccggtaacggcgtcgaatttcgcatctgg
gcgccgaacgcgaaacgcgtcgatgtcgtgctcgaccgtccgcatccgatgcggcgcgac
gccatgggctggtacaccacccacatcgacggcatcggcgctggcgcacgctatcgcttc
ctgatcgacggcagcctcgatgtgccggacccggcctcgctgtttcagcccgaggatctg
gccggaccgagcgaagtgatcgaccacgccgcgtatcaatggcgcgccaaggaatggcac
ggacggccctgggccgaaaccgtgctgctcgaaacccatgtcggcaccttcacgcccgag
ggcagctttcgcgcgatgatcgacaagctcgaccatctggtcgacaccggcatcaccgcg
ctggaattgatgccgctcgccgatttccccggcacgcgcaattggggctacgacggcgtg
ctgtggtatgcgccggacagcgcctatggccgtcccgaggatctcaaggcgctgatcgac
gaggcgcatctgcgcggcctgatggtgttcctcgacgtcgtctataaccatttcggcccc
gaagggaattacctcggccaatacgcacccgggttcttctccgattcgcacacgccgtgg
ggcaacggcatcaactactacgtcgagcaggtccgcgccttcgcgatcgagaacgcgttg
tactggttggacgattatcgtttcgacgggctacggctcgacgcggtacatgcgatcccc
gatcagggcgaaatcccgatgctggacgagctgtcgcgcgaagtcggccggctcgccgcg
gagaccgggcgctacgtgcatctggtgctcgagaacgacgacaacaccgccgccgtgctc
gatccggtcacccatccgccgcgggggcaatatcgcgcgcaatggaacgacgactaccac
cacgcctggcacgtcgcgctgaccggcgagactcacggctactattcagattacgccaat
gcgccgctggcgcatcttgcccgcgcgctcggctccggcttcgtgtttcagggcgagccg
tcggaacatcgcggcggccagccgcgcggcgaaccgagcggagacctcgtgccgctcgcc
ttcatcaacttcctgcagaaccacgatcagatcggcaaccgcgcgcttggcgaccggctg
gaaagcctggttaagccgcaggcgatcgaagcggcgctcgccgtcacgctgctggcgccg
acggtgccgatgctgttcatgggcgaggaatggggatcgcaggcgccgttcccgttcttc
tgcgattttcaaggcgatcttgccgaagcggtgcgggccggacggcgcaaggaattcgcc
ggcgcctacaaagagtacggcgacgaggtccccgatccgctcagcaaggacgcgttcgac
agcgccgtgctcgattggcacgagcgcgaccagggccgcggcgccgcgcgtctggccctc
gtcaagcgcctgctcgccatccgccaccgcgagatcgtgccgcggcttgacagctcgcgg
ttcggcgacgctcggatcaccggcgatggcctgctgaaggcgttctggcggctcaccgac
ggtgcgacgctcgaactcgtcgccaatctgtcggacgacgaacgtgacggcggggcgcca
cccgcggcgggaactattctatggggcggcgattggaaccggatcattccgccttgggcg
gtgtcctggcgcctcgagcatccgtaa

DBGET integrated database retrieval system