KEGG   Rhodopseudomonas palustris CGA009: RPA3655Help
Entry
RPA3655           CDS       T00153                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPA3655
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA3655
  Lipid metabolism
   00071 Fatty acid degradation
    RPA3655
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPA3655
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPA3655
   00626 Naphthalene degradation
    RPA3655
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPA3655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4127608..4128660)
Genome map
AA seq 350 aa AA seqDB search
MRSFRVTDFGKPLSEDNRPTPELTGTQVLVRVKAAGICHSDLHIWEGGYELGHGRKKLSL
ADRGVALPLTMGHETVGEIVAAGPDAKDAKIGQVALVYPWIGCGECDVCKAGDENMCLKP
RFLGVYCDGGYSDELIVPHPRYLLSLDGLDPVTAAPYACSGITTYSALKKLDFCLDSPIV
IFGAGGLGLMALELLKAMGGKGAIMVDIDAAKREAAQKAGALGAVDGAAPDALAQIAASA
KGPVRGALDLVGNPQTAQLGFDCLTKGGKLVIVGLFGGGAPWALPFIPMRAITIQGSYVG
NLAETQELLDLVRAKKVSPIPVTKVALPQAYDALIDLQKGKLVGRAVLTP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctttcgcgtcaccgatttcggcaagccgctgagcgaagacaaccgaccgacg
ccggaactgaccggcacgcaagtgctggtccgcgtcaaggccgccggcatctgccatagc
gatctgcacatctgggaaggcggttacgaactcggccacggccgcaaaaagttgtcgctc
gccgatcgcggcgtcgcattgccgctgacgatgggccacgagaccgtcggcgagatcgtc
gccgccggccccgacgccaaggatgccaagatcgggcaggtcgcgctggtgtatccgtgg
atcggctgcggcgaatgcgacgtctgcaaggccggcgacgagaatatgtgcctgaagccg
cggtttctcggcgtgtattgcgacggcggctactcggacgaactgatcgtgccgcatccg
cgctatctgctcagccttgatgggctcgatccggtgaccgcagcgccctatgcgtgctcc
ggcatcaccacctacagcgcgctgaagaagctcgacttctgcctcgacagcccgatcgtg
atcttcggtgccggcggactcggattgatggcgctggagctgctcaaggcgatgggcggc
aagggcgccatcatggtcgatatcgatgcggccaagcgcgaggcggcgcagaaggcgggc
gcgcttggcgcggtcgatggcgccgcgccggacgcgctggcgcagattgcggccagcgcc
aaaggtccggtgcgcggtgcgctggatctggtcggcaatccgcagaccgcgcagctcggc
ttcgattgtctcaccaagggcggcaagctggtgatcgtcggtctgttcggcggcggcgcg
ccgtgggcactgccgttcatcccgatgcgcgccatcaccatccagggcagctatgtcggc
aatctcgccgaaacccaggaactgctcgacctcgtccgcgccaagaaggtgtcgccgatc
ccggtcaccaaggtggcgttgccgcaggcttacgatgcgctcatcgatctgcagaagggc
aagctggtcggtcgcgcggtgctgacgccgtag

DBGET integrated database retrieval system