KEGG   Rhodopseudomonas palustris CGA009: RPA3693Help
Entry
RPA3693           CDS       T00153                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpa00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4168719..4169273)
Genome map
AA seq 184 aa AA seqDB search
MDTFELNKIVGAIFGTLLILLLSNFTAQAIFSPTKPEKQGYAIVVKEAEPAQAKDAAPKA
DEPIEKLLQTASVDQGSKVAKKCAACHTFEKDGPNRVGPNLYGIVGDHRGEGRNGFNFSA
AMKAKGGAWTFDELNKFLASPKGYIPGTAMSFAGVPNDKERADLIAYLNKNSDKPEALPA
AAEK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatactttcgaactcaacaaaattgtcggcgcgatcttcgggaccttgctgatcctg
ctgctgtccaatttcaccgcccaggcgatcttctctccgaccaagcctgaaaaacagggc
tatgccatcgtagtgaaggaagccgagcctgcgcaggcgaaggatgctgcgccgaaggcg
gacgagccgatcgagaagctgctgcagactgcgtcggtcgatcagggctccaaggtcgcc
aagaagtgcgcggcctgccacaccttcgagaaggatggcccgaaccgcgtcggcccgaac
ctctacggcatcgtcggcgaccatcgcggcgaaggccgaaacggtttcaatttctcggct
gcgatgaaggccaagggcggcgcctggacgttcgacgagctcaacaagttccttgcgagc
ccgaagggctacatcccgggtaccgcgatgagcttcgccggcgtcccgaacgacaaggaa
cgggccgacctgatcgcctatctcaacaagaattccgacaagcccgaggcgctgccggcg
gcggccgagaagtaa

DBGET integrated database retrieval system