KEGG   Rhodopseudomonas palustris CGA009: RPA3705Help
Entry
RPA3705           CDS       T00153                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RPA3705 (glpK)
Enzymes [BR:rpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RPA3705 (glpK)
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPA3705 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4183381..4184883)
Genome map
AA seq 500 aa AA seqDB search
MPFVMAIDQGTTSSRAILFRSDISIAASAQQEFPQHFPASGWVEHEPEDIWATTIATCRA
AMDKAGATAADIAAIGITNQRETVVVWDAVSGQAIHRAIVWQDRRTAEFCTRLKADGLEP
MVTAKTGLIIDPYFSGTKVAWLLDNVPGARARAERGELKFGTVDCYLLWRLTGGKVHATD
ATNASRTLLFNIHDGAWDDELLKLLGVPRSMLPEVKDSSAHFGDSVPELFGGSITIRGIA
GDQQAATIGQACFTPGMIKSTYGTGCFALLNTGATPVKSNNKLLTTVAYQLDGKRTYALE
GSIFVAGSAVQWLRDGLGVIKHASETGPLADKSDSAQSVYLVPAFVGMGAPYWNPRVRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPDADAATTVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLSAGVFPEPQKFADNWRLDHRFRPAMSAATRE
RKLAGWGRAVKGLLATDEGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgtcatggccatcgatcagggcaccacctcgtcgcgggcgattctgtttcgt
tccgacatttcgatcgcggcctccgcgcagcaggaattcccgcagcatttcccggcgtcc
ggctgggtcgagcacgagcccgaggacatctgggcgacgaccattgctacctgtcgcgct
gcgatggacaaggccggcgcgaccgccgccgacatcgccgcgatcggcatcaccaaccag
cgcgaaaccgtggtggtgtgggacgcggtgtccggccaggcgatccaccgcgccatcgtc
tggcaggatcgccgcaccgcggagttctgcacccggctgaaggccgacgggctggagccg
atggtcaccgccaagaccgggctgatcatcgatccgtatttctccggcaccaaggtcgcc
tggctgctcgacaacgtgcccggcgcacgcgctcgcgccgagcgtggcgagctgaaattc
ggcaccgtcgattgctatctgctgtggcggctgaccggcggcaaggtccacgccaccgac
gccaccaatgcgtcgcgcacgctgctgttcaacatccacgacggcgcctgggacgacgag
ctgctcaagctgctcggcgtgccgcgctcgatgctgccggaggtgaaggattcatcggcg
catttcggcgacagcgtgccggagctgttcggcggctcgatcaccatccgcggcatcgcc
ggcgaccagcaggcggcgaccatcggccaggcctgcttcaccccgggcatgatcaaatcg
acctacggcaccggttgcttcgcgctgctcaacaccggcgcgacgccggtgaagtcgaac
aacaagctgctgaccacggtcgcctatcagctcgacggcaagcgcacctatgcgctcgag
ggctcgatcttcgtcgccggcagcgcggtgcaatggctgcgcgacggcctcggcgtcatc
aagcacgcctccgagaccgggccgctcgccgataaatcggattcggcgcagagcgtgtat
ctggtgccggcgttcgtcggcatgggcgcgccgtattggaatccgcgggtccgcggcgcg
ctgttcggcctgacgcgcaacaccggcccggccgaactcgcccacgccgccctggagagc
gtgtgctaccagaccttcgatctgtgggcggcgatgcgggccgactggccggatgccgac
gccgccaccaccgtgctccgcgtcgacggcggcatgaccgcctcggactggaccatgcag
cgtctcgccgatcttttagacgcgccggtcgatcgcccggtgatccaggaaaccaccgcg
ctcggcgccgcctacctcgccggcctcagtgcaggcgtcttccccgagccgcaaaaattc
gccgacaactggcgcctcgaccaccgcttccgccccgcgatgagcgcagcgacgcgcgag
cgtaaattggcgggctggggcagagcggtgaagggattgttggcgacggatgagggggag
tag

DBGET integrated database retrieval system