KEGG   Rhodopseudomonas palustris CGA009: RPA4033Help
Entry
RPA4033           CDS       T00153                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPA4033 (hemD)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RPA4033 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4562147..4562992
Genome map
AA seq 281 aa AA seqDB search
MAERLQGTRILILETREEAQFARLLTEQGADVLQCPMFEIRDAPDPAPVSAWIDRLIAAP
FDDLVLLTGEGLRRLTKLARATGRERPFVAAVGRTRTFIRGPKPGRALREIGLEPQVTAE
APTSEGVAATLKRYDLAGRRIGVQLYPERDHAALLDSITAQDATVDAVLPYSYDARAAEQ
TVVTAVEEMAQGRVDALALTSSGQVRRLFDVARAHDCEDRLRDGLSRTPIASVGPVVTEE
LAAHGFAPTITPANEAFFMKPLINAMIVALGGRTPRNTAAG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacggctccaaggcacccgtatcctgatcttggagacccgcgaggaggcccag
ttcgcccggctgctgaccgaacagggcgccgacgtcctgcagtgcccaatgttcgaaatc
cgcgatgcgcccgaccccgctccggtctcggcctggatcgaccggctgatcgccgcgccg
ttcgacgatctagtgctgctgaccggtgaaggcctgcgccggctgaccaagctggcccga
gcgaccggccgcgaacggcctttcgtggcggccgtgggccggacgcgaacgttcatccgt
ggaccgaagcctggccgggcgttgcgcgagatcgggctggagccgcaggtgaccgccgaa
gcaccgacctccgagggcgtcgccgccacgctgaaacgttatgatctcgccgggcgccgg
atcggcgttcagctctatcccgaacgggaccacgccgctttgctcgattctattacggcg
caagacgccaccgtcgatgcggtgctaccttattcctacgacgcgcgtgctgccgaacag
acagtcgtcactgccgtcgaggagatggcgcaaggccgagtcgatgcgctggcgctgacc
agttccggtcaggtccggcggctgttcgacgtcgcccgcgcgcacgactgcgaagaccgc
ctccgcgacgggttaagccgcacgccgatcgcctcggtcggtccggtggtgaccgaggaa
ctcgccgcgcacggcttcgcgccgaccatcacccccgccaatgaggcattcttcatgaag
ccgctgatcaacgcgatgatcgtcgcactcggcggacgcacgccacgcaacacagcggca
ggctga

DBGET integrated database retrieval system