KEGG   Rhodopseudomonas palustris CGA009: RPA4147Help
Entry
RPA4147           CDS       T00153                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpa00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4688895..4690361
Genome map
AA seq 488 aa AA seqDB search
MISRRSRALRPEVFRGFSRVELRINSKVLLATLMITDDDAMIGPDEVGLSEPAFRRFNEP
VGSAVSVTPARSPASLDAVRAKIQGHTLSAAEITAIVDDLAHFRYSDMEIAAFLISAARF
TTTDELLALVGAMASVGTKLTWDTPIVVDKHCIGGIPGNRTTMIVVPIVAAHGLMIPKTS
SRAITSPAGTADTMELLARVDLDVEQMKQVVHACGGCLVWGGHVNLSPADDILISVERPL
SLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSAKVTNANEAMRLRKLFEFVGDHFGISV
EVVTTDGRQPIGRGIGPVLEARDVMAVLGNEPGAPADLREKSLRLAAHLLEYDPKLRGGT
GYARAKELLDSGAALKKMQQIIDAQGPSPCPAELGSYAADVLAAADGVVNGIDCLRINRL
ARSAGAPVAKGAGIDLFKKIGDRVEKGEPLYRVYASDRSEFDLALAAAQAESGFAINHHT
PADVDLVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccgccgctcgcgcgccctgcgccccgaggtgtttcgcggcttcagccgcgtc
gaactgcgcatcaactccaaggtgctgctggcgacgctgatgatcaccgacgacgacgcg
atgatcggccccgacgaagtcggcctgtccgagccggcgttccgccgcttcaatgagccg
gtcggcagtgccgtgtcggtgacgccggcgcggtcgcccgcaagcctcgacgcggtacgc
gccaaaatccagggccacaccctgtcggctgcggagatcaccgcgatcgtcgatgacctc
gcgcacttccgttactccgacatggaaatcgcggcgttcctgatcagcgccgcgcgcttc
accacgaccgacgaactgctggcgctggtcggcgcgatggcctcggtcggtaccaaactg
acatgggacacgccgatcgtcgtcgacaagcactgcatcggcggcattcccggcaaccgc
accaccatgatcgtggtgccgatcgtcgccgcgcacggactgatgattccgaagacctcg
tcgcgcgccatcacctcgccggccggcaccgccgacaccatggaactgctggcgcgggtc
gatctcgacgtcgagcagatgaaacaggtggtgcacgcctgcggcggctgtttggtgtgg
ggcggccacgtcaacctgtcgccggccgatgacatcctgatctcggtcgagcgaccgctc
agcctcgacacgccggagcagatggtcgcctcgatcatgtcgaagaagctcgccgccggc
tcaacccgattgctgatcgacttcccggtcggcccgtccgccaaagtcaccaacgccaac
gaggcgatgcggctgcgcaaactgttcgagttcgtcggcgatcatttcgggatcagcgtc
gaagtggtgaccaccgacggccggcagccgatcggccgcggcatcggcccggttctggaa
gcgcgcgacgtcatggcggtgctcggcaacgagcccggcgcacccgctgacttgcgcgaa
aaatcgctgcggctcgctgcgcatctgcttgaatacgacccgaagctccgcggcggcacc
ggctatgcccgcgccaaggagttgctcgacagcggggctgcgctgaagaagatgcagcag
atcattgacgcgcaggggccttcgccgtgtccggccgagctcggcagctacgccgccgat
gtactcgctgcggccgatggcgtggtcaacggcatcgactgtctgcgcatcaaccggctc
gcccgcagcgccggcgcgccggtcgccaagggcgccggcatcgatctgttcaagaagatc
ggcgaccgcgtcgaaaagggcgagccactgtatcgggtctatgcgtccgaccgctccgaa
tttgatctcgcgctggcagccgcacaggcagagtccgggttcgcgatcaatcatcacacg
cccgccgacgtggatctggtgtcgtga

DBGET integrated database retrieval system