KEGG   Rhodopseudomonas palustris CGA009: RPA4216Help
Entry
RPA4216           CDS       T00153                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPA4216 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPA4216 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RPA4216 (glcB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPA4216 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4759508..4761682
Genome map
AA seq 724 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAKEAAPKTGIAPDVFWAGLAAIVRDLAPKTRALLKTRDDLQ
AKIDAWHLANKGKKQDMAAYTTFLKEIGYLLPEPPTVPVETTNIDEEIGKLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPQEATQAKGYDKARGDKVIAKAKAFLDQAAPLA
TGSHSDVTGYSVIAGQLSAKLKSGNATGLKKPAQFAGFRGDAANPSAVLLVNNGLHIEIK
IDRANTIGKDDPAGVADLVIESAVSTILDMEDSVAAVDADDKVLIYRNTLGLMDGTLSES
FEKGGKTVTRALNGDRTYTAPDGKEISLHGRSLLLMRNVGHHMWTDAVLDSDGQEIPEGF
LDAAVSGLIAIHDLKHLGKTRNSRTGSVYIVKPKMHGPDEVALTVELFGRVETMLGLTAN
TLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWIKAYEDWNVDTGLVDGLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPSP
TAATLHALHYHQVDVIARQQELAKGGPRAKLEDILTIPVSNSNWAPDDVRQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKEQVLDSLKRM
AVIVDKQNEGDALYRPMAPDFDGVAFEAACDLIFKGRAQPNGYTEYILHERRREAKAAHL
ESAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattgacgcccacggactgaaaatcgcgcctgtgctgttcgacttcatcgcc
aaggaggccgcgccgaaaaccggcatcgctcccgacgtattctgggccggcctcgctgcg
atcgttcgtgatctggcgccgaagacccgcgcgctgctgaagacccgcgacgacctgcag
gccaagatcgatgcgtggcatctcgccaacaagggcaagaagcaggacatggcggcctac
actaccttcctgaaggagatcggctacttgctgcccgagccgccgaccgtgccggtcgag
accaccaatatcgacgaagagatcggcaagctgtgcggcccgcagctcgtggtaccgttg
tcgaacgctcgctacgcactgaatgccgccaacgcgcgctggggttcgctgtacgacgcg
ttctacggcaccgacgcgatcccgcaggaagccacccaggccaagggctacgacaaggcg
cgcggcgacaaggtgatcgccaaggccaaggcgttcctcgaccaagccgcgccgctcgcg
accggcagccacagcgacgtcactggttacagcgtgatcgccggccagctgtcggccaag
ctgaagagcggcaatgccaccggcctgaagaagccggcgcagttcgccggcttccgcggc
gatgccgccaatccgagcgcggtgctgctggtcaacaacggcctgcacatcgagatcaag
atcgatcgcgccaacaccatcggcaaagacgatccggccggcgtcgccgacctggtcatc
gagtcggcggtgtcgaccattctcgacatggaagactcggtcgccgccgtcgacgccgac
gacaaggtgctgatctatcgcaacaccctcggcctgatggacggcacgctgtcggaaagc
tttgagaagggcggcaagaccgttacccgcgcgctcaacggcgaccgcacctacacggcg
ccggacggcaaggaaatctcgctgcacggccgcagcctgctgctgatgcgcaacgtcggt
caccacatgtggaccgatgcggtgctcgacagcgacggccaggagattccggaaggcttc
ctcgacgctgcggtgtcaggcctgatcgcgatccacgatctcaagcacctcggcaagacc
cgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccggatgaa
gtcgccctcaccgtcgagctgttcggccgcgtcgagaccatgctcggcctgaccgcgaac
accctcaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctcaaggcctgc
atccagaacgcgtcgaagcggatcgtcttcatcaacacgggcttcctcgatcgcaccggc
gacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccctggatcaaggcctacgaagactggaacgtcgacacgggtctggtcgacggcctg
ccgggtcacgcccagatcggcaagggcatgtgggcggcccccgacaagatggccgacatg
ctggcgcagaagatcggtcacccgcaggccggcgcgaccaccgcctgggtgccgtcgccg
actgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgatcgcgcgccagcag
gagctggcgaagggcggcccgcgcgccaagctcgaggacatcctcaccattccggtgtcg
aactcgaactgggcgccggacgatgtccgccaggagatcgacaacaactgccagggcatc
ctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggacatc
cacgatgtcggcctgatggaagaccgcgccacgctgcgcatttccagtcagcacctcgcc
aactggctgcatcacggcgtcgtcaccaaggagcaggtgctcgactcgctgaagcggatg
gcggtgatcgtcgacaagcagaacgaaggcgatgcgctgtaccggccgatggcgccggac
ttcgacggcgtcgcgttcgaagccgcgtgcgacctgatcttcaagggccgcgcgcagccg
aacggctacaccgaatacatcctgcatgagcgccgccgcgaggccaaggccgcgcacctg
gagtcggcgcgctaa

DBGET integrated database retrieval system