KEGG   Rhodopseudomonas palustris CGA009: RPA4216Help
Entry
RPA4216           CDS       T00153                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPA4216 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPA4216 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RPA4216 (glcB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPA4216 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4759508..4761682
Genome map
AA seq 724 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAKEAAPKTGIAPDVFWAGLAAIVRDLAPKTRALLKTRDDLQ
AKIDAWHLANKGKKQDMAAYTTFLKEIGYLLPEPPTVPVETTNIDEEIGKLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPQEATQAKGYDKARGDKVIAKAKAFLDQAAPLA
TGSHSDVTGYSVIAGQLSAKLKSGNATGLKKPAQFAGFRGDAANPSAVLLVNNGLHIEIK
IDRANTIGKDDPAGVADLVIESAVSTILDMEDSVAAVDADDKVLIYRNTLGLMDGTLSES
FEKGGKTVTRALNGDRTYTAPDGKEISLHGRSLLLMRNVGHHMWTDAVLDSDGQEIPEGF
LDAAVSGLIAIHDLKHLGKTRNSRTGSVYIVKPKMHGPDEVALTVELFGRVETMLGLTAN
TLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWIKAYEDWNVDTGLVDGLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPSP
TAATLHALHYHQVDVIARQQELAKGGPRAKLEDILTIPVSNSNWAPDDVRQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKEQVLDSLKRM
AVIVDKQNEGDALYRPMAPDFDGVAFEAACDLIFKGRAQPNGYTEYILHERRREAKAAHL
ESAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattgacgcccacggactgaaaatcgcgcctgtgctgttcgacttcatcgcc
aaggaggccgcgccgaaaaccggcatcgctcccgacgtattctgggccggcctcgctgcg
atcgttcgtgatctggcgccgaagacccgcgcgctgctgaagacccgcgacgacctgcag
gccaagatcgatgcgtggcatctcgccaacaagggcaagaagcaggacatggcggcctac
actaccttcctgaaggagatcggctacttgctgcccgagccgccgaccgtgccggtcgag
accaccaatatcgacgaagagatcggcaagctgtgcggcccgcagctcgtggtaccgttg
tcgaacgctcgctacgcactgaatgccgccaacgcgcgctggggttcgctgtacgacgcg
ttctacggcaccgacgcgatcccgcaggaagccacccaggccaagggctacgacaaggcg
cgcggcgacaaggtgatcgccaaggccaaggcgttcctcgaccaagccgcgccgctcgcg
accggcagccacagcgacgtcactggttacagcgtgatcgccggccagctgtcggccaag
ctgaagagcggcaatgccaccggcctgaagaagccggcgcagttcgccggcttccgcggc
gatgccgccaatccgagcgcggtgctgctggtcaacaacggcctgcacatcgagatcaag
atcgatcgcgccaacaccatcggcaaagacgatccggccggcgtcgccgacctggtcatc
gagtcggcggtgtcgaccattctcgacatggaagactcggtcgccgccgtcgacgccgac
gacaaggtgctgatctatcgcaacaccctcggcctgatggacggcacgctgtcggaaagc
tttgagaagggcggcaagaccgttacccgcgcgctcaacggcgaccgcacctacacggcg
ccggacggcaaggaaatctcgctgcacggccgcagcctgctgctgatgcgcaacgtcggt
caccacatgtggaccgatgcggtgctcgacagcgacggccaggagattccggaaggcttc
ctcgacgctgcggtgtcaggcctgatcgcgatccacgatctcaagcacctcggcaagacc
cgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccggatgaa
gtcgccctcaccgtcgagctgttcggccgcgtcgagaccatgctcggcctgaccgcgaac
accctcaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctcaaggcctgc
atccagaacgcgtcgaagcggatcgtcttcatcaacacgggcttcctcgatcgcaccggc
gacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccctggatcaaggcctacgaagactggaacgtcgacacgggtctggtcgacggcctg
ccgggtcacgcccagatcggcaagggcatgtgggcggcccccgacaagatggccgacatg
ctggcgcagaagatcggtcacccgcaggccggcgcgaccaccgcctgggtgccgtcgccg
actgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgatcgcgcgccagcag
gagctggcgaagggcggcccgcgcgccaagctcgaggacatcctcaccattccggtgtcg
aactcgaactgggcgccggacgatgtccgccaggagatcgacaacaactgccagggcatc
ctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggacatc
cacgatgtcggcctgatggaagaccgcgccacgctgcgcatttccagtcagcacctcgcc
aactggctgcatcacggcgtcgtcaccaaggagcaggtgctcgactcgctgaagcggatg
gcggtgatcgtcgacaagcagaacgaaggcgatgcgctgtaccggccgatggcgccggac
ttcgacggcgtcgcgttcgaagccgcgtgcgacctgatcttcaagggccgcgcgcagccg
aacggctacaccgaatacatcctgcatgagcgccgccgcgaggccaaggccgcgcacctg
gagtcggcgcgctaa

DBGET integrated database retrieval system