KEGG   Rhodopseudomonas palustris CGA009: RPA4394Help
Entry
RPA4394           CDS       T00153                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPA4394 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPA4394 (aceA)
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RPA4394 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4946355..4947989)
Genome map
AA seq 544 aa AA seqDB search
MNFQPRGISAIHAPTSYKSEIEAAEALLKDKPTWNGVTAEAVARMRLQNRFKTGLDIARY
TAAQMRADMAAYDADPTKYTQSLGCWHGFIAQQKLISIKKHGGGRTDRRYIYLSGWMIAA
LRSEFGPLPDQSMHEKTSVPALIEEIYTFLRQADSRELNDLFRQLDKAREAGDKAKETAI
IDQIDNFQTHVVPIIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDG
KVTVPHDVFIAKVRAIRHAFLEMGVEDGIIVTRTDSLGAGLTQQIAVSHQPGDIGDQYNS
FLDCEEVDASKIGNGDVIISRNGKLLRPKRLPSNLYQFRPGTGADRCVLDCITSLQNGAD
LLWIETEKPHIEQIASMVDRIREVVPNAKLAYNNSPSFNWTLNFRWQVYDAWKEEGKDVS
KYNRAELMKAEYDETPLAIEADARIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAR
EYFGDQGMLGYVKNVQRQEIRQGIACVKHQNMAGSDIGDDHKEYFAGDAALKAGGEHNTM
NQFS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccagccacgcggcatcagcgccatccacgctccgacctcctacaagagcgag
atcgaagcggccgaagctctcctcaaggacaagccgacctggaatggcgtcaccgccgag
gccgtggctcggatgcggctgcagaaccgcttcaagaccggtctggacatcgcccgttac
accgcggcccagatgcgcgccgacatggcggcgtatgacgccgacccgaccaagtacacc
cagtcgctgggctgctggcacggcttcatcgcgcagcagaagctgatctcgatcaagaag
cacggcggtggccgcaccgaccgtcgttacatctacctgtcgggctggatgatcgcggcg
ctgcgctcggagttcggcccgctgcccgaccagtcgatgcacgagaagacctcggtgccg
gcgctgatcgaagagatctacaccttcctgcgccaggcggattcgcgcgagctgaacgac
ctgttccgccagctcgacaaggcccgcgaggccggcgacaaggccaaggaaaccgcgatc
atcgaccagatcgacaatttccagacccacgtcgtgccgatcatcgccgacatcgacgcc
ggcttcggtaacgccgaggcgacctatctgctcgccaagaagatgatcgaagcgggcgcc
tgcgcgctgcagatcgagaaccaggtctcggacgagaagcagtgcggccaccaggacggc
aaggtcaccgtgccgcacgacgtgttcatcgccaaggttcgcgcgatccgtcacgccttc
ctcgagatgggcgtggaagacggcatcatcgtcacccgcaccgactcgctcggcgccggc
ctgacccagcagatcgccgtcagccatcagccgggtgacatcggcgaccagtacaacagc
ttcctggattgcgaagaagtcgatgccagcaaaatcggcaacggcgacgtgatcatcagc
cgcaacggcaagttgctgcgtccgaagcgcctgccgagcaacctgtaccagttccgtccg
ggcaccggcgcggaccgctgcgtgctggactgcatcacctcgctgcagaacggcgccgac
ctgctgtggatcgaaaccgagaagccgcatatcgagcagatcgcctcgatggtcgatcgg
atccgcgaagtcgtgccgaacgccaagctggcctacaacaactcgccgtcgttcaactgg
acgctcaacttccgctggcaggtctatgacgcctggaaggaagagggcaaggacgtcagc
aagtacaaccgcgccgagctgatgaaggccgaatacgacgaaactccgctggcgatcgaa
gccgacgcccgcatccgcaccttccaggcggattcggccaagcgcgccggcatcttccac
cacctgatcacgctgccgacctaccacacggctgcgctgtcgaccgacaacctggcccgc
gaatatttcggcgaccagggcatgctgggttatgttaagaacgtgcagcgccaggaaatc
cgtcagggcatcgcctgtgtgaagcaccagaacatggccggctcggatatcggcgacgat
cacaaggaatacttcgccggcgacgcggctctgaaggccggcggcgaacacaacacgatg
aaccagttcagctaa

DBGET integrated database retrieval system