KEGG   Rhodopseudomonas palustris CGA009: RPA4531Help
Entry
RPA4531           CDS       T00153                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rpa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5111807..5113102)
Genome map
AA seq 431 aa AA seqDB search
MPLRLDNASPDFASKFKAFLAMKREVAADIEAATRAIVDDVAHRGDAALLEATEKFDRLT
LDAAGMRVGEAEVEAAVKACDSETVDALKLARDRIEFFHRRQLPKDDRFTDPLGVELGWR
WSAIEAVGLYVPGGTAAYPSSVLMNAIPAKVAGVERVVMVVPSPGGTLNPLVLAAAQLAG
ATEIYRIGGAQAVAALAYGTATIAPVAKIVGPGNAYVAAAKRLVFGRVGIDMIAGPSEVV
VVADKTANPDWIAADLLAQAEHDANAQSILITDSAVLAADVERALAAQLTTLPRVKIARA
SWDEFGAIIKVAKLEDAVPLANAIAAEHLEIMTADPEAFADKIRNAGAIFLGGHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVLDFMKRTSILKCGPEQLAVLGPAAMALGKAEGLDAH
ARSVGLRLNQR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccccttcgtctcgataacgccagtcccgatttcgcttccaaattcaaagccttcctg
gcgatgaagcgggaggttgcggcggatatcgaggccgccacccgggccatcgtcgacgac
gtcgcgcatcgcggcgacgctgcgctgctggaagcgaccgaaaagttcgaccggctgacg
ctggatgccgccggcatgcgggtcggcgaggccgaggtcgaagccgccgtgaaggcgtgc
gattccgagacggtcgacgcgctgaagctggcgcgcgaccgcatcgaatttttccatcgc
cggcaattgccgaaggacgatcgcttcaccgatccgctcggcgtcgagctcggctggcgc
tggagcgcgatcgaggcggtcggcctgtacgtgcccggcggcaccgcggcgtatccgtcg
tcggtgctgatgaatgcgattccagccaaggtcgccggtgtcgagcgcgtggtgatggtg
gtgccgtcgcccggcggcacgctcaatccgctggtgctggccgcggcgcagctcgctggc
gccaccgagatctaccgtatcggcggcgcacaggcggtggctgcgttggcctacggcacc
gcgacgattgcgccggttgccaagatcgtcggccccggcaacgcttatgtcgctgcagcc
aagcgcctggtgttcggccgcgtcggcatcgacatgatcgctggcccgtccgaggtcgtc
gtcgtcgcagacaagaccgccaatccggattggattgcggccgatttgttggcgcaggcc
gagcacgacgccaatgcgcaatcgattctgattaccgatagcgcggtgctcgccgccgac
gtcgagcgcgccttggcggcgcagctcaccacgctgccgcgcgtcaagatcgcgcgcgcc
tcgtgggacgagttcggcgccatcatcaaggtcgccaagctggaggatgcggtcccgctc
gccaacgcgatcgcggccgagcatctcgagatcatgacggccgatccggaagcgttcgcc
gacaagatccgcaatgccggcgcgatcttcctcggcggccatacgccggaagcgatcggc
gactatgtcggcggctccaaccacgtgctgccgaccgcgcgttcggcgcggttctcgtcg
ggcctcggcgtgctcgacttcatgaagcgcacctcgatcctgaagtgcgggcccgaacag
ctcgccgtgctcggcccggccgcgatggcgctcggcaaggccgaaggattggatgcgcat
gcgcgatcggtgggactgcgtctgaatcagcgatga

DBGET integrated database retrieval system