KEGG   Rhodopseudomonas palustris CGA009: RPA4584Help
Entry
RPA4584           CDS       T00153                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rpa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5166277..5167413)
Genome map
AA seq 378 aa AA seqDB search
MLTRRTIACTALGLIALCWSVQAGAQNRCTGPTSGVPPETIAALARGVNVSNWTENARLQ
GPSPELLRAVRGAGFTHVRLPVAGDLVMRAFSPPATIERQLAGVDAALTELIGLGFYVSV
DLHPGDGFGRLHRDDPKASMAALTDAWSNLATVIRKHPAERVFAELLNEPDIAPDRWQSE
VEQLAVFVRGLLPQTTLIVGPTYWQRADSLPQFRPLADRNVVYALHFYDPMVFTHQGHWD
PANPLSRVRDLPFPLVANDPAVERLRSELTLRGDNEALQELDKAIVQAGSPSYVARQLIP
AVAWQERYARPLIINEFGVFKPAAPRDSRLRWLESVVDSAEANCWGWTYWELDQGFGLAD
PRTGRLDVGVIDALMHPR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgctcacccgacgcacgatcgcttgcaccgccctcggactgatcgctctgtgctggagc
gtgcaagctggcgcgcagaaccgctgcaccggcccgacatccggcgttccgcctgagacg
atcgcggcgctggcccgcggcgtgaacgtctcaaactggaccgagaacgcgcgcctgcaa
ggaccaagtccagaattgctccgcgcagtgcgcggcgccggcttcacccatgttcggcta
ccggtcgccggcgatctggtgatgcgcgccttcagtccgccggccaccatcgaacgacag
ctcgccggcgtcgatgccgcgctcaccgagctgattggcctcggcttctatgtttcggtt
gacctgcacccgggcgatggtttcggtcgcctccaccgcgacgaccccaaggcctcgatg
gcggcgctgaccgatgcgtggagcaatctagcgacggtgatccgcaagcatccggccgag
cgcgtgttcgccgagctgttgaacgagcctgatattgcgccggatcgttggcagagcgag
gtcgaacagctcgccgtcttcgtgcgtgggctgttgccgcagactacgctgatcgtcggg
ccgacctattggcagcgcgccgactcgctcccgcagttcaggccgctcgccgaccgcaac
gtcgtctatgcgctgcatttctatgatccgatggtgttcacccatcagggtcattgggat
ccggccaatccgctgagccgggttcgcgacctgccattcccgctggtcgccaacgatccc
gccgtcgagcggctgcgcagcgagctgaccttgcgcggcgataatgaagcgctgcaggag
ctggacaaagcgatcgttcaggccggctcgccgagctatgtggcccggcagttgattccg
gccgtcgcctggcaggagcgctacgcacgaccgctgatcatcaatgagttcggcgtgttt
aagccggcggcgccgcgggacagcaggctgcgctggctggaatcggtggtggactcggcc
gaagccaattgctggggctggacctattgggagttggatcagggatttggtctggccgat
ccgcgcactggcaggttggacgtcggcgtaattgatgcgctgatgcatccgcgttga

DBGET integrated database retrieval system