KEGG   Rhodopseudomonas palustris CGA009: RPA4643Help
Entry
RPA4643           CDS       T00153                                 

Gene name
cbbT1
Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Anoxygenic photosynthesis in purple bacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:rpa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpa01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rpa00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rpa00710]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5226783..5228750)
Genome map
AA seq 655 aa AA seqDB search
MANAIRFLAIDGVEKAKSGHPGMPMGMADVATVLFTRFLKFDPADPAWADRDRFVLSAGH
GSMLLYALLHLTGYPDVTIDQLKSFRQWGSKTPGHPEYGHTQGVETTTGPLGQGLATSVG
MALAERMMNARYGDALVDHHTYVIAGDGCLMEGVSHEAISLAGHLKLNKLIVLWDDNHIS
IDGDTSLSCSDDQLARFAASGWATTRVDGHDPEAVAAAIEQAKKSDRPSLIACRTTIGFG
SPKVAGTEKAHGAPLGADEVEKTRAALNWPHPPFEIPDPILARWREAGGRGKAAHEAWTQ
RLAAADAATRTGFTDALAGKLSADYEGALQGLIAKFDADKPTIATRQASQLTIDAIVPAS
PNILGGSADLTHSNLTHAKGTASVKPGAFGGSYLHYGIREFGMAAAMNGIALHGGFVPFG
GTFLVFADYSRPAIRLAALMGVRVIHVMTHDSIGLGEDGPTHQPVEHVPSLRAIPNVLVF
RPADAIETAQAWDCALKQTSRPSVLALSRQGLPALPRPNGATGNPVARGAYVVVDPGQRD
VTLIATGSEVSLALDAASKLEAEGIKAAVVSAPCFELFADQDDAYRASVLGTAPRIGIEA
ARDTDWRRWIGDTGAFVGMTGFGASAPAPVLYQKFGITADAVVDAAKGAIARGKH
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgcgatccgctttctcgctatcgacggtgtcgagaaggcgaagtccggccac
ccgggcatgccgatgggcatggccgacgttgccaccgtgctgttcacccgcttcctgaag
ttcgatccggccgatccggcctgggccgaccgcgaccggttcgtgctgtcggccggccac
ggctcgatgctgctgtacgcgctgctgcatctgaccggctatccggacgtgacgatcgat
cagctgaagtcgttccggcagtggggttcgaagaccccaggccatccggaatacggccac
acccagggcgtcgagaccaccaccggcccgctcggccaggggcttgcgacctcggtcggc
atggcgcttgccgaacgcatgatgaatgcacgctacggcgacgcgctggtcgatcaccac
acctacgtcatcgccggcgacggctgcctgatggaaggcgtcagccacgaggcgatctcg
ctggccggccacctcaagctcaacaagctgatcgtgctgtgggacgacaaccacatctcg
atcgacggcgacacctcgctgtcgtgctcggacgatcagctcgcgcgcttcgccgcgtcg
ggctgggccaccactcgcgtcgacggtcatgatccggaagcggtcgcggccgcgatcgag
caggccaagaagagcgaccgtccgtcgctgatcgcctgccgcaccacgatcggcttcggc
tcgccgaaggtcgcgggcaccgagaaggcgcacggcgccccgctcggcgccgacgaggtc
gagaagacccgcgccgcgctgaactggccgcatccgccgttcgaaatccccgatccgatc
ctggcgcgctggcgcgaggccggcggccgcggcaaggcggcgcacgaggcctggacccag
cgtctggcagcggccgacgctgcgacccgcaccggcttcaccgatgcgctcgccggaaag
ctgtcggcggactacgaaggcgcgctgcagggcctgatcgccaagttcgacgccgacaag
ccgaccatcgccacccgtcaggcgtcgcagctcaccatcgacgccatcgtgccggcgtcg
ccgaacatcctcggcggctcagccgacctgacgcactccaacctgacgcatgccaagggc
accgcgtcggtgaagccgggtgcgttcggcggctcctacctgcactacggcatccgcgaa
ttcggcatggcggcggcgatgaacggcatcgcgctgcacggcggcttcgtgccgttcggc
ggcaccttcctggtgttcgccgactatagccgtccggcgatccgccttgcggcgctgatg
ggcgtccgcgtcatccatgtgatgacccacgactcgatcggcctcggcgaagacggtccg
acccatcagccggtcgagcacgttccctcgctgcgcgcgatcccgaacgtcctggtgttc
cgcccggccgacgcgatcgaaaccgcgcaggcctgggactgcgcgctgaagcagacctcg
cgtccgtcggtgctggcgctgtcgcgccagggcctgccggcgctgccgcgtccgaacggc
gcgaccggcaacccggtggcgcgcggcgcttacgtcgtggtcgatcccggccagcgcgac
gtcaccctgatcgccaccggctcggaagtgtcgctggcgctggatgcggcgtccaagctg
gaagccgaaggcatcaaggcagcggtggtgtcggccccgtgcttcgaactgttcgccgac
caggacgacgcgtaccgcgccagcgtgctcggcaccgcgccgcggatcggcatcgaagcg
gcgcgcgacaccgattggcgccgctggatcggcgataccggtgcgttcgtcggcatgacc
gggttcggtgcctcggcgccggcgccggttctgtaccagaagttcggcatcaccgcggac
gcggtggtggacgccgccaagggcgcgatcgcccgcggtaagcactga

DBGET integrated database retrieval system