KEGG   Rhodopseudomonas palustris CGA009: RPA4646Help
Entry
RPA4646           CDS       T00153                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Brite
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     RPA4646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5231249..5231998
Genome map
AA seq 249 aa AA seqDB search
MSEAVMAGAEAFAFDGGKTGVLLVHGFTGSPQSMRYLGERLGERGYSILGPRLPGHGVSP
AAMAKTTANDWVNCAEDALLELSAKCDKTFVAGLSMGGTLSLYLAASHPDKVAGVIPINA
AVQIDSPDLAGLAYARGLPEFVPGIGSDMVDTSTKELAYDQVPVTCVKQVMGLAATARAL
LPRIKCPTLVINSRVDHVLSPANATVIANHVGSSRIETLWLDNSYHVATIDNDKDLIAAE
IDSFVTRNL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcggtgatggccggcgcggaggcgttcgcgttcgacggcggcaaaacgggc
gtgctgctggtgcatggatttaccggcagcccacagagcatgcgctatctcggcgaacgg
ctcggcgagcgcggctattccattctcggcccgcggctgcccggacacggcgtctcgccg
gccgcgatggccaagaccaccgccaacgactgggtcaactgcgccgaggacgcgctgctg
gagctgtcggccaaatgcgacaaaaccttcgtggccggactgtcgatgggcggcacgctg
tcgctgtatctggccgcctcgcatccggacaaggtcgccggcgtgatcccgatcaacgct
gccgttcagatcgactcgcccgatctcgccgggttggcttacgcccgcggcctgccggaa
ttcgtccccggcatcggctcggacatggtcgacacctccaccaaggagctggcctacgac
caggtgccggtgacctgcgtcaagcaggtgatgggactggccgccaccgcccgcgcgctg
ctgccgaggatcaagtgcccgaccttggtgatcaactcgcgcgtcgaccacgtgctgtcg
ccggccaatgcgaccgtcatcgccaaccacgtcggctccagccggatcgaaacgctgtgg
ctggacaattcctatcacgtcgccacgatcgacaacgacaaggacctgatcgccgccgag
atcgacagtttcgtgacgcggaacctgtga

DBGET integrated database retrieval system