KEGG   Rhodopseudomonas palustris CGA009: RPA4729Help
Entry
RPA4729           CDS       T00153                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA4729 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RPA4729 (rocF)
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RPA4729 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5340028..5341011
Genome map
AA seq 327 aa AA seqDB search
MSQTDIAHSESARRVALLGVPIEIGAGLRGTLMGPAALRTAGIGRVLDQLGFAVEDHGDM
TRPALDGGNDPVPANANYYSEVRSWVGAISARAYELARSGAVPLFMGGDHSLSMGSVNGV
ARYWQSEGKPLFVLWLDAHADYNTPATTLTANMHGMSAAFLCGEPGLDDLLGDEPRVSIP
PSRLDLFGIRSIDPLEKDLVRQRAIPVVDMRAIDEFGVGVLIRRVIDRVRAAGGVLHLSF
DVDVLDPSVAPGVGTTVPGGATYREAHLVMELLHDSGLVRSVDIVELNPFLDERGRTARV
AVELLGSLFGMQITDRVTPSNAVLPEG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaccgacatcgctcacagcgagtccgcgcgccgcgttgcgctgctcggcgtg
ccgatcgagatcggcgccgggcttcgcggcacgctgatgggaccggcggcgctgcgcacc
gccggcatcggccgggtgctcgatcagctcggctttgcggtcgaggatcatggcgacatg
acgcgcccggcgctggacggcggcaacgatccggtgccggccaacgccaattactacagc
gaggtgcggagctgggtcggcgcgatctcggcgcgcgcctacgagcttgcacgctccggc
gcggtgccgctgttcatgggcggcgatcacagcctgtcgatgggctcggtcaacggcgtc
gcgcgctattggcagagcgagggcaagccgctgttcgtgctgtggctcgacgcccatgcc
gactacaacacgccggccacgacgctgaccgccaacatgcacggcatgtcggcggcgttc
ctgtgcggcgagccgggactcgatgatctgctcggcgacgagccgcgggtgtcgattccg
ccgagccggctcgatttgttcggcatccgctcgatcgatccgctggagaaggacctggtg
cggcaacgcgcgatcccggtggtcgacatgcgggcgatcgacgaattcggcgtcggcgtg
ctgatccgccgcgtcatcgaccgcgtccgcgccgccggcggcgtgctgcatctgtcgttc
gacgtcgacgtgctcgatccctcggtcgcacccggcgtcggcaccaccgtgccgggcggc
gccacctatcgcgaggcgcatctggtgatggagctgctgcacgactccggcctcgtccgc
tcggtcgacatcgtcgagctcaatccgttcctcgacgaacgcggccgcaccgcgcgggtc
gcggtcgagctgctcggcagcctgttcggcatgcagatcaccgaccgggtgaccccgagc
aacgccgtgctgccggaggggtga

DBGET integrated database retrieval system