KEGG   Rhodopseudomonas palustris HaA2: RPB_0277Help
Entry
RPB_0277          CDS       T00321                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPB_0277
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPB_0277
  Amino acid metabolism
   00310 Lysine degradation
    RPB_0277
Enzymes [BR:rpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPB_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(311163..312398)
Genome map
AA seq 411 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKQGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA
KDGETVAVGALLGQISEGGGAAKPAAPAKPAAAPAAAAAAPAAAAPKAAPADAPQAPSVR
RLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRAPSPADDAA
REERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRSQYKDVFEKKHGAKLGF
MGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAVGTDKGLVVPVVRDCDEKSIAA
IEKGIADFGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQSAILGMHKIQER
PVVVAGKIEIRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgcgttccgacgctcggcgaatccgtgaccgaggcgaccatcggccgc
tggttcaagaagcagggtgacgccgtcgcggtcgacgagccgctggtcgaactcgagacc
gacaaggtcaccatcgaagtgccggcgccgtcggccggcaccctcggcgaaatcatcgcc
aaggacggcgagaccgtcgccgtcggcgcgctgctgggccagatctcggaagggggcggt
gccgccaagcccgccgcgccggccaagccggccgccgcgccggctgccgccgctgcagcg
cccgctgcggccgcgcccaaggccgcgccggccgatgcgccgcaggcaccgtcggtgcgg
cggctgtcgaccgagagcggcgtcgatgcctcgaccgtgccgggctccggcaaggacggc
cgcgtcaccaagggcgacatgctggcggcgatcgagaaggcggcgtcggcgccgaccccg
gtcaaccagcccgccgccgccgtccaggtccgcgccccgtcgccggccgacgatgccgcg
cgcgaggagcgcgtcaagatgacccggctgcgccagaccatcgcgcgccggctcaaggaa
gttcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgaccaacgtcatg
gcgctgcgcagccaatacaaggacgtgttcgagaagaagcacggcgccaagctcggcttc
atgggcttcttcacaaaggcctgcgtgcaagcgctgaaggacatcccggcggtcaatgcc
gagatcgacggcaccgatttgatctacaagaactactaccatgtcggcgtcgcggtcggc
accgacaagggcctggtggtgccggtggtgcgcgattgcgacgagaagtcgatcgccgcg
atcgagaagggcattgccgatttcggcaagcgcgcccgcgacggccagctcaagatcgag
gaaatgcagggcggcaccttcacgatcaccaatggcggcatctacggctcgctgatgtcg
acgccgatcctcaacgcgccgcagtcggcgatcctcggcatgcacaagatccaggagcgg
ccggtggtcgtcgccggcaagatcgaaatccggccgatgatgtatctggcgctcagctac
gatcaccgcgtgatcgacggcaaggaagcggtgaccttcctggtccgcgtcaaggaaagc
ctggaagacccggcccggctggtgctggatctgtaa

DBGET integrated database retrieval system