KEGG   Rhodopseudomonas palustris HaA2: RPB_0280Help
Entry
RPB_0280          CDS       T00321                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00020  Citrate cycle (TCA cycle)
rpb00640  Propanoate metabolism
rpb00660  C5-Branched dibasic acid metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01130  Biosynthesis of antibiotics
rpb01200  Carbon metabolism
Module
rpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPB_0280
   00640 Propanoate metabolism
    RPB_0280
   00660 C5-Branched dibasic acid metabolism
    RPB_0280
Enzymes [BR:rpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RPB_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABD04991
JGI: RPB0280
UniProt: Q2J3G9
Position
complement(316530..317726)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGVPVSHGYPIFKASEAEAAATKLGGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRLAKSVDEVKTYAEQMLHATLVTVQTGPAGKQVNRLYIEEGSEIDKEFYL
SLLVDRATSRISFVVSTEGGMSIEDVAHDTPEKIVSFTVDPATGIMSHHGRAVANALGLK
GDQAKQAESLVTKLYTAFLAKDMEMLEINPLVLTKQGDLKCLDAKMSFDGNSLYRHADIQ
GLRDESEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMATMDIIKLYGMTPANFLDVG
GGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDIIAEGVVAAVKEVGLDVPLVVRLE
GTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVNAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaataccaggccaaagcggtgctgcgcgaattcggcgtgccggtgtcg
cacggctatccgatcttcaaggcgtccgaggcggaggccgccgccaccaagctcggcggt
ccggtctgggtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaagcctccgccggcgacaagggcggcgtgcgcctcgccaagtcggtcgacgaggtcaag
acttacgccgagcagatgctgcacgcgacgctggtgacggtgcagaccggcccggccggc
aagcaggtcaaccggctgtacatcgaggaaggctccgagatcgacaaggagttctatctg
tcgctgctggtcgaccgcgccacctcgcggatctccttcgtggtctcgaccgaaggcggc
atgtcgatcgaggacgtcgcccatgacacccccgaaaagatcgtgtcgttcacggtggat
ccggcgaccggcatcatgagccatcacggccgcgccgtcgccaacgcgctggggctgaag
ggcgaccaggccaagcaggccgaaagcctggtgaccaaattgtacaccgcgttcctcgcc
aaggacatggagatgctcgagatcaacccgctggtgctgaccaagcagggcgatctcaaa
tgcctcgacgccaagatgtcattcgacggcaattcgctgtatcgccacgccgacattcag
ggcctgcgcgacgagagcgaggaagacgccaaggaaatcgaggcgtcgaaatacgacctc
aactacgtcaccctcgacggcaccatcggctgcatggtcaacggcgctggcctcgcgatg
gcgacgatggacatcatcaagctctacggcatgacccccgccaacttcctcgacgtcggc
ggcggcgccagcaaggagaaggtgaccgcggcgttcaagatcatcaccgccgatccgaac
gtgaagggcatcctgatcaacatcttcggcggcatcatgaagtgcgacatcatcgccgag
ggcgtcgtcgccgcggtgaaggaagtcggcctcgacgtgccgctggtggtgcgcctcgaa
ggcaccaatgtcgaagccggcaagaagatcatcaagcattccggcctcaacgtgctgccc
gccgacaatctcgacgatgccgcgcagaagatcgtcaatgccgtcaagggagcctga

DBGET integrated database retrieval system