KEGG   Rhodopseudomonas palustris HaA2: RPB_0284Help
Entry
RPB_0284          CDS       T00321                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RPB_0284
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RPB_0284
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RPB_0284
Lipid biosynthesis proteins [BR:rpb01004]
 Fatty acid synthase
  Component type
   RPB_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(320974..321582)
Genome map
AA seq 202 aa AA seqDB search
MAPTRQAEAQTAAKPLKVVVLGDSLSAGYGLPANAAFPAKLQKALQAKGIATDMINAGVS
GDTASGGLARLDWSVPPDTDAVIVELGANDALRGTDPKVPQQALDEIVKRLKARNIAVLL
TGMLAPPNYGPDYAKQFNAIYPDLAKKYDVPLYPFFLDGVAAVAGLNQPDGIHPTAAGID
LVVANILPTVEAFLRSVAGQKG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgacccggcaggccgaggcgcagacggccgccaagccgctgaaggtggtggtg
ctgggtgactcgctgtccgccggttatggactaccggccaatgcagcgtttccggccaag
ctgcagaaagcgctgcaggccaaggggatcgcgaccgacatgatcaatgccggggtgtcg
ggcgacaccgccagcggcgggctcgcccggctcgactggtcggtgccgccggacaccgat
gcggtgatcgtcgagctcggtgccaacgacgcgctgcgcggcaccgatcccaaggtcccg
caacaggcgctggacgagatcgtcaaacggctgaaagcgcgcaacatcgcggtgctgctc
accggaatgctggcgccgccgaattacgggccggactacgccaaacagttcaacgcgatc
tatcccgatctggcgaaaaaatacgacgtgccgctgtacccgttcttcctcgacggcgtc
gccgcggtggccggcctcaatcagccggacggcatccacccgaccgcagcgggcatcgac
ctggtggtcgccaacatcctgcccacagtggaggcatttctgcgatcggtcgctgggcag
aaaggctga

DBGET integrated database retrieval system