KEGG   Rhodopseudomonas palustris HaA2: RPB_0314Help
Entry
RPB_0314          CDS       T00321                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(357590..358387)
Genome map
AA seq 265 aa AA seqDB search
MPAAATAPVSLSQARTSGVALLVTRPQPDNDATAAALRAKGYDVLLAPMLRFEPAPFPDD
QDTDYTGVIVTSANALRAIADQPGFARLLKLPLFAVGKHTARAARDAGFKDVIVAEGDAA
RLRLKVADSVKGKKKAAGALLYLAGADLSRDLAGELREDGFHVVMQTTYRMLPVQTLPAT
ICDEFAANRIEAVLHYSRRSARAFIDATRASGIEISALAIPQCCLSDSVSDVVREAGATQ
VMVARTPDEKALFEALDRAVGAPAR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcggccgcaacggctcctgtttccctctcacaggcgaggacgtcaggcgtggca
ctgcttgtcacccgcccgcaacccgacaacgacgccaccgccgccgcgctgcgcgcgaag
ggctacgacgtgctgctggcgccgatgctgcggttcgagccggcgccgtttccggacgat
caggacaccgactatacgggcgtgatcgtcaccagcgccaatgcgctgcgggcgatcgcc
gatcagcccggtttcgcgcggctgctgaagctgccgctgttcgcggtcggcaagcacacc
gcgcgcgcggcccgcgacgccggcttcaaggacgtcatcgtcgccgagggcgacgccgcc
agactgcggctgaaggtcgccgatagcgtcaaagggaaaaagaaggcggccggcgcgttg
ctgtatctggccggcgccgatctgtcgcgcgacctcgccggcgaattgcgcgaggacggc
ttccacgtggtgatgcagacgacctacaggatgctgccggtgcagacgctgccggcgacc
atctgcgacgaatttgcggccaatcggatcgaggcggtgctgcattactcgcggcgcagc
gcgcgcgccttcatcgacgcgacgcgggcgtccgggatcgagatctcggcgctggcgatt
ccgcaatgctgcctgtcggactcggtgtccgacgtggtgcgcgaggccggcgcgacgcag
gtgatggtggcgcgcacgcccgacgagaaggcgctgttcgaggcgctggaccgtgcggtc
ggtgcgcccgcgcgctga

DBGET integrated database retrieval system