KEGG   Rhodopseudomonas palustris HaA2: RPB_0326Help
Entry
RPB_0326          CDS       T00321                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPB_0326
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPB_0326
   00650 Butanoate metabolism
    RPB_0326
  Energy metabolism
   00190 Oxidative phosphorylation
    RPB_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(371494..371916)
Genome map
AA seq 140 aa AA seqDB search
MSVEESHGTARRRERTMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLILPVIVVIMM
LLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNF
FSIAVALAAIFAIFKLASGV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgaggaatcccacggcaccgcacggcggcgcgagcgcacgatgcgcacgccg
atgggcaaggtgcgcaagctcggcccggccggctccggcacctcggacttctggcagcag
cgcatcaccggcgtggcgatgacgctgctgatcctgccggtgatcgtcgtgatcatgatg
ctgctcggccgcaatcaggccggcgcggcgcagatcctcggttcgccgctgatctcgctg
accatgatcctgttcatcatcgccagcgcgatccacatgaagatcggcatgcaggtggtg
atcgaggactacatccagaacgagaagctcaagctcgtcacggtgatggccaacaatttc
ttttcgatcgccgtggcgctcgccgcgatcttcgcgatcttcaaactcgcatccggagtg
taa

DBGET integrated database retrieval system