KEGG   Rhodopseudomonas palustris HaA2: RPB_0338Help
Entry
RPB_0338          CDS       T00321                                 

Definition
(RefSeq) aspartate-semialdehyde dehydrogenase (EC:1.2.1.11)
  KO
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    RPB_0338
   01230 Biosynthesis of amino acids
    RPB_0338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_0338
   00270 Cysteine and methionine metabolism
    RPB_0338
   00300 Lysine biosynthesis
    RPB_0338
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    RPB_0338
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     RPB_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
383425..384459
Genome map
AA seq 344 aa AA seqDB search
MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDRTLKCKALEHY
DFSDIDICLMSAGGAVSKEWSPKIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFT
KKNIIANPNCSTAQLVVALKPLHDKAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTN
QELINKKFPKRIAFNVIPEIDVFMEDGYTKEEWKMMVETKKILDPAIKLSATCVRVPVFV
GHSEAVNIEFENPISADEARDILRSAPGCLVIDKQEPGGYVTPYEAAGEDATYISRIRTD
PTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggttacaaagtcgcggtagtgggtgcgaccggcaatgtcgggcgcgaaatgctcgcc
attctggacgagcgcaagttcccggcggacgaggtggtggcgctggcgtcgcgccgctcg
atcggcgtcgaggtcagctacggcgacaggaccctgaaatgcaaggcgctggagcactac
gatttcagcgacatcgacatctgcctgatgtcggccggcggcgccgtgtcgaaggaatgg
tcgccgaagatcggcgcgcagggcgcggtggtgatcgacaattccagcgcctggcggatg
gacccggacgtgccgctgatcgtgcccgaagtgaacgccgcggccgccgcgggcttcacc
aagaagaacatcatcgccaatccgaactgctcgaccgcgcagctcgtggtggcgctgaag
ccgctgcacgacaaggcgaagatcacccgcgtggtggtgtcgacctatcagtcggtgtcg
ggcgccggcaaagagggcatggacgaactgttctcgcagaccaaggccgtctacaccaat
caggaactgatcaataagaagttcccgaagcggatcgccttcaacgtgatccccgagatc
gacgtcttcatggaggacggctacaccaaggaagagtggaagatgatggtcgagaccaag
aagattctcgatcccgccatcaagctctcggccacctgcgtgcgggtgccggtgttcgtc
ggccattccgaagcggtcaatatcgagttcgagaacccgatctccgccgacgaggcccgc
gacatcctgcgcagcgcgccgggttgcctggtgatcgacaagcaggagccgggcggctac
gtcacgccgtatgaagccgccggcgaggacgcgacctatatcagccgcatccgcaccgac
ccgaccgtcgacaacggcctggtgctgtggtgcgtctcggacaatctgcgcaagggcgcg
gcgctgaacgcgatccagatcgccgaagtgctgatcaaccgcaagctgatcaccgcgaag
aagaaagcggcgtag

DBGET integrated database retrieval system