KEGG   Rhodopseudomonas palustris HaA2: RPB_0338Help
Entry
RPB_0338          CDS       T00321                                 

Definition
aspartate-semialdehyde dehydrogenase (EC:1.2.1.11)
Orthology
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    RPB_0338
   01230 Biosynthesis of amino acids
    RPB_0338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_0338
   00270 Cysteine and methionine metabolism
    RPB_0338
   00300 Lysine biosynthesis
    RPB_0338
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     RPB_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
383425..384459
Genome map
AA seq 344 aa AA seqDB search
MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDRTLKCKALEHY
DFSDIDICLMSAGGAVSKEWSPKIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFT
KKNIIANPNCSTAQLVVALKPLHDKAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTN
QELINKKFPKRIAFNVIPEIDVFMEDGYTKEEWKMMVETKKILDPAIKLSATCVRVPVFV
GHSEAVNIEFENPISADEARDILRSAPGCLVIDKQEPGGYVTPYEAAGEDATYISRIRTD
PTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggttacaaagtcgcggtagtgggtgcgaccggcaatgtcgggcgcgaaatgctcgcc
attctggacgagcgcaagttcccggcggacgaggtggtggcgctggcgtcgcgccgctcg
atcggcgtcgaggtcagctacggcgacaggaccctgaaatgcaaggcgctggagcactac
gatttcagcgacatcgacatctgcctgatgtcggccggcggcgccgtgtcgaaggaatgg
tcgccgaagatcggcgcgcagggcgcggtggtgatcgacaattccagcgcctggcggatg
gacccggacgtgccgctgatcgtgcccgaagtgaacgccgcggccgccgcgggcttcacc
aagaagaacatcatcgccaatccgaactgctcgaccgcgcagctcgtggtggcgctgaag
ccgctgcacgacaaggcgaagatcacccgcgtggtggtgtcgacctatcagtcggtgtcg
ggcgccggcaaagagggcatggacgaactgttctcgcagaccaaggccgtctacaccaat
caggaactgatcaataagaagttcccgaagcggatcgccttcaacgtgatccccgagatc
gacgtcttcatggaggacggctacaccaaggaagagtggaagatgatggtcgagaccaag
aagattctcgatcccgccatcaagctctcggccacctgcgtgcgggtgccggtgttcgtc
ggccattccgaagcggtcaatatcgagttcgagaacccgatctccgccgacgaggcccgc
gacatcctgcgcagcgcgccgggttgcctggtgatcgacaagcaggagccgggcggctac
gtcacgccgtatgaagccgccggcgaggacgcgacctatatcagccgcatccgcaccgac
ccgaccgtcgacaacggcctggtgctgtggtgcgtctcggacaatctgcgcaagggcgcg
gcgctgaacgcgatccagatcgccgaagtgctgatcaaccgcaagctgatcaccgcgaag
aagaaagcggcgtag

DBGET integrated database retrieval system