KEGG   Rhodopseudomonas palustris HaA2: RPB_0444Help
Entry
RPB_0444          CDS       T00321                                 

Definition
PfkB protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPB_0444
   01230 Biosynthesis of amino acids
    RPB_0444
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPB_0444
   00030 Pentose phosphate pathway
    RPB_0444
   00051 Fructose and mannose metabolism
    RPB_0444
   00052 Galactose metabolism
    RPB_0444
  Energy metabolism
   00680 Methane metabolism
    RPB_0444
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPB_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(490104..491042)
Genome map
AA seq 312 aa AA seqDB search
MVEIVTLTPNPAIDLSTSVARMVPSRKLRCAAQQRDPGGGGINVARVVKRFGGDVEAIYP
AGGFTGRLLRALLDREQIPSRVVEAVAETREDFSVTESETGQQFRFVLPGEALAEGEWRG
LLEILGGTDPAPTIVVGSGSLPPGVPHDFYAQAAAVAKRIGAQFFLDTSGDQLIAALAHG
VTLIKPNLREMQELAGRPLANDQDYVAAARQQIDAGKVEIVALSLGHLGALLVTKDKALR
SPALPVAQVSTVGAGDSFLGAIAFSLAKGRPIEDAFRLALASGSASLTMHGTELCRPADV
ERLSAEVVIQPL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagatcgtgaccctcacgcccaatcccgccatcgatctgtcgacctcggtcgcc
cgcatggtgccgagccgcaagctgcgctgcgcggcgcagcagcgtgatcccggcggcggc
ggcatcaatgtggcgcgggtggtgaagcggttcggcggcgacgtcgaggcgatctatccg
gccggcggcttcaccggccggctgctgcgcgcgctgctcgaccgcgagcagatcccgagc
cgcgtcgtcgaggcggtggccgagacccgcgaggatttctccgtcacggaatcagagacc
ggccagcagttccgcttcgtgctgccgggcgaggccttggccgagggcgagtggcgcggg
ctgctggagattctcggcgggaccgatccggcaccgaccatcgtggtcggctcgggcagc
ctgccgcccggcgtgccgcatgatttctacgcccaggccgccgcggtggcgaagcggatc
ggcgcgcagttctttctcgacacctccggcgaccagctgatcgccgcgctcgctcatggc
gtcacgctgatcaaaccgaatctgcgcgagatgcaggaattggccggccggccgctcgcc
aatgatcaggactacgtcgccgccgcgcggcagcagatcgacgccggcaaggtcgagatc
gtcgcgctgtcgctcggccatctcggcgcgctgctggtcaccaaggacaaggcgctgcgt
tcgccggcgctgccggtcgcgcaggtctccaccgtcggcgccggcgacagtttcctcggc
gcgatcgccttcagcctggccaaggggcggccgatcgaggacgccttccggctggcgctg
gcttcgggctcggcgtcgctcaccatgcacggcaccgaattgtgccggccggccgatgtc
gaacgattgagcgccgaggtggtgatccagccgctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system