KEGG   Rhodopseudomonas palustris HaA2: RPB_0445Help
Entry
RPB_0445          CDS       T00321                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RPB_0445
  Lipid metabolism
   00561 Glycerolipid metabolism
    RPB_0445
   00600 Sphingolipid metabolism
    RPB_0445
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RPB_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
491316..492596
Genome map
AA seq 426 aa AA seqDB search
MARTTRIVLLGASSASFGLSMLRDLFATPELRGSTLVMVGLDAARLATMAELAKLLNATT
GAGFVIEHTTDRRAALDGASFVINATAIDRNRLWKMDFEVPKKHGIRHPLGENGGPGGLF
FTLRTLPLVFDFIRDIEELCPEALFLNYSNPESRIVLALGRYSKVRCIGLCHGIFMGRDA
VADIMGLPRERVEVWGAGLNHFQCLLQIRDRLTGEDLAPRLRAAEQSFDPNAWRFTRRLY
RAFGHWLTCSDDHLGEYLAYGWEAGERGYDFAGDDRSRVETLAQIDAVLAGTMPIPHWWT
EPSGERGAAVIAAMLHDQKRFIESGIVMNRGVIPNLPAELAVEVPVTVDAAGVHPVSLGP
LPDPIAKLMLMQASVQQLAVEAAVHASKELALQALLIDPVVNSAVAAEKILDELWEINRP
YIRACV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccagaacgaccaggatcgtgttgctcggcgccagcagtgcgtcattcggcctcagc
atgttgcgcgatctgttcgccacgccggagctgcgcgggtcgacgctggtgatggtcggg
ctcgatgcggcgaggctcgcgaccatggccgagctggcgaagctgctgaacgcgacgacc
ggcgccggcttcgtcatcgaacacaccaccgaccgccgcgccgcgctggacggcgcaagc
ttcgtcatcaacgccaccgcgatcgatcgcaaccggctgtggaagatggatttcgaggtg
ccgaagaagcacggcatccggcatccgctgggtgagaacggtggccccggcggattgttc
ttcacgttgcggacgctgccgctggtgttcgatttcatccgcgacatcgaggagctttgc
cccgaggcgctgtttctcaactactccaatccggaaagccgcatcgtgctggcgctcggg
cgctattcgaaggtgcgctgcatcggcctgtgtcacggcatcttcatgggccgcgacgcc
gtcgccgacatcatgggactgccgcgcgagcgcgtcgaggtgtggggcgcggggctcaat
cacttccagtgcctgctgcagatccgcgaccgcctcaccggcgaagacctcgcgccgcgg
ctgcgcgcggcggagcagagcttcgatcccaatgcctggcgcttcacccggcggctgtat
cgcgccttcggccactggctgacctgcagcgacgatcatctcggcgagtatctggcttac
ggctgggaggccggcgagcgcggctatgatttcgccggcgacgaccgcagccgcgtcgag
accctggcgcagatcgacgccgtgctggccgggacgatgccgatcccacattggtggacc
gagccctcgggcgagcgcggcgccgcggtgatcgccgcgatgctgcacgaccagaagcgc
ttcatcgaatccggcatcgtgatgaaccgcggcgtcatccccaatctgccggcggagctc
gccgtcgaggtgccggtgacggtcgacgccgccggggtgcatccggtgtcgctcggtcca
ctaccagatccgatcgccaagctgatgctgatgcaggccagcgtgcagcaactcgcggtc
gaggcggcggtgcacgcctcgaaagaactcgcgctgcaggcgctgctgatcgacccggtg
gtcaactcagcggtcgccgcggaaaagatcctcgacgagctgtgggagatcaaccggccc
tatatcagggcgtgcgtgtag

DBGET integrated database retrieval system