KEGG   Rhodopseudomonas palustris HaA2: RPB_0635Help
Entry
RPB_0635          CDS       T00321                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00260  Glycine, serine and threonine metabolism
rpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
rpb01230  Biosynthesis of amino acids
Module
rpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPB_0635
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPB_0635
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPB_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABD05346
JGI: RPB0635
UniProt: Q2J2G4
Position
complement(720399..721613)
Genome map
AA seq 404 aa AA seqDB search
MNQILPNSFRSGPDERGHFGIFGGRFVAETLMPLILALEKAYAEAKDDPAFRAEMDGYLK
HYVGRPSPLYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLARRMGKPRIIAE
TGAGMHGVATATMCAKFGLQCVVYMGAVDVDRQQPNVLRMKALGAEVRPVTSGAATLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQEVRAQIMEAEGRLPDSLIA
CIGGGSNAMGLFHPFLDDSSVAIYGVEAAGHGLSKLHAASIAGGKPGVLHGNRTYLLMDT
DGQIQEAHSISAGLDYPGIGPEHAWLHDVGRVEFMSATDTEALDAFKLCCRLEGIIPALE
PAHALAKVGDLAPPLPKDHVMVLNMSGRGDKDLASVAEHLGGQF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatcctgccgaactcgtttcgatccggtcccgacgagcgcgggcatttcggc
atcttcggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgcgctggaaaag
gcctacgcggaagccaaggacgatccggcgttccgcgccgagatggacggctacctcaag
cactatgtcggccggccgtcgccgctgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgcgaggacctcaaccacaccggcgcccacaaggtgaac
aacgtgctcggccagatcatgctggcgcggcggatgggcaagccgcggatcatcgccgaa
accggcgccggcatgcacggcgtcgccaccgcgacgatgtgcgcgaaattcggcctgcaa
tgcgtcgtctatatgggcgcggtcgacgtcgaccggcagcagcccaacgtgctgcggatg
aaggcgctcggcgccgaagtccgcccggtgacgtccggcgccgccacgctcaaggacgcg
atgaacgaggcgctgcgcgactgggtcaccaacgtccacgacacgttctattgcatcggc
accgtcgccggcccgcacccctatccgatgatggtgcgcgacttccaggcggtgatcggc
caggaagtgcgcgcgcagatcatggaagccgaaggccggctgccggattcgctgatcgcc
tgcatcggcggcggctccaatgcgatgggactgtttcatcccttcctggatgatagcagc
gtcgcgatctacggcgtcgaggccgcgggccacggcctcagcaagctgcatgcggcgtcg
atcgccggcggcaagcccggcgttctgcacggcaaccgcacctatctgctgatggacacc
gatggccagatccaggaagcgcattcgatctcggccggcctcgactatccgggcatcggc
ccggaacacgcctggctgcacgatgtcggccgcgtcgagttcatgtccgccaccgacacc
gaggcgctcgacgccttcaagctgtgctgccggctggagggcatcatcccggcgctggag
ccggcccatgcgctggcgaaagtcggcgacctcgccccgcccctgccgaaggatcatgtg
atggtgctcaacatgtcgggccgcggcgacaaggatctcgcttcggtcgccgaacatctc
gggggccagttctga

DBGET integrated database retrieval system