KEGG   Rhodopseudomonas palustris HaA2: RPB_0704Help
Entry
RPB_0704          CDS       T00321                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPB_0704
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPB_0704
Enzymes [BR:rpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     RPB_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(790115..791536)
Genome map
AA seq 473 aa AA seqDB search
MPQATVDRASEFLGGLFTSLTERGRSLFKSSSDQPKSKDELIALGEALLSRRGEATGVAM
AHQLLSGYDGAAEDDQLGFLDALAEQFGPDLAELTAAVENFHVSGASPDAASQLLKAAEP
RRQELIRRLNLAPGGTASLVRMREAVLTHLRDHPQLRNVDDDFVHLFTSWFNRGFLVLQR
IDWTTPANILEKIIRYEQVHAIRNWDDLRARLAPADRRCYGFFHPQLVDEPLIFVEVALT
LDRPGAIAPLLDLERAPISPKDATTAVFYSISNTQKGLAGISFGNFLIKQVVEEIKRELP
NVQSFVTLSPVPGFAKWLKQERADEASALLDDSARAELAVLDAPDWQDDPERADHIKPLL
LPLAAAYFLQAKNARGLPLDPVARFHLGNGARLESLNFLGDRSPNGMRQSHGLMVNYLYA
LGEIEANHEAFAERAQIAAASAVRKQLPSKPLSSEPRKTNGKTSAPLAIAPPA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagcgaccgtcgatcgcgcgtcggagtttctcggcggcctgttcacgagcctc
accgaacgtggccgcagcctgttcaagtcgagcagcgaccagccgaagagcaaggacgaa
ctgatcgcgctcggcgaggcgctgctgtcacgccgcggcgaggccaccggcgtggcgatg
gcgcatcaattgttgtccggctatgacggcgccgccgaggacgatcagctcggcttcctc
gacgcgctggccgaacaattcggccccgatctcgccgaactcacggcggccgtcgaaaac
ttccatgtcagcggcgcatcgccggacgccgcctcgcaactcctcaaggccgccgagccg
cgccggcaggagctgatccgccggctcaacctcgcgccgggcggcaccgcgtcgctggtg
cggatgcgcgaggcggtgctgacgcatctgcgcgaccacccgcaactcaggaacgtcgac
gacgatttcgtgcatctgttcacctcctggttcaatcggggctttctggtgctgcaacga
atcgactggactacgccggccaacattctcgagaagatcattcgctacgagcaggtccac
gccatccgcaattgggacgatctgcgcgcacgactcgcgccggcggaccggcgctgctac
ggcttcttccatccgcagctcgtcgacgagccgctgattttcgtcgaggtggcgctgacg
ctggatcgcccgggtgcgatcgcgccgctgctcgatctggagcgggcgccgatctcgccc
aaggatgcgaccacggcggtgttctactcgatctccaatacccagaagggcctcgccggc
atctcgttcggcaatttcctgatcaagcaggtggtcgaggagatcaagcgcgagctgccc
aacgtgcagagcttcgtcacgctgtcgccggtgccgggcttcgcgaaatggctgaagcag
gagcgcgccgacgaggcgtcggcgttgctcgacgactccgcccgtgccgaactcgcggtg
ctggacgcgccggattggcaggacgatcccgaacgcgccgatcacatcaagcctttgctg
ctgccgctggcggccgcgtacttcctgcaggccaagaatgcccgcggcctgccgctcgac
ccggtagcgcgcttccatctcggcaacggcgcgcggctggagagcctcaatttcctcggc
gaccgctcgcccaacgggatgcggcaatcgcacggactgatggtgaactatctgtatgcg
ctcggcgagatcgaggccaaccacgaggccttcgccgaacgcgcccagatcgcggccgcc
tccgcggtccgtaagcaactgccgtccaagccgctgagcagcgagccgcgcaagaccaac
ggcaagacctccgccccgctggcgatcgcaccgccggcgtga

DBGET integrated database retrieval system