KEGG   Rhodopseudomonas palustris HaA2: RPB_0842Help
Entry
RPB_0842          CDS       T00321                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00220  Arginine biosynthesis
rpb00330  Arginine and proline metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
rpb01230  Biosynthesis of amino acids
Module
rpb_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RPB_0842
   00330 Arginine and proline metabolism
    RPB_0842
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RPB_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABD05553
JGI: RPB0842
UniProt: Q2J1V7
Position
complement(957753..958739)
Genome map
AA seq 328 aa AA seqDB search
MTPSSSVIPPDPNRRVALLGVPIEIGAGLRGTLMGPAALRTAGIGRVLEQLRITVEDHGD
MARPPPCRDAGPTPANANYYDEVKSWVGAISARAHELARSGAVPLFMGGDHSLSMGSVNG
VARYWQTQGRPLFVLWFDAHADYNTPATTLSANMHGMSAAFLCGEPGLDALLGDEPRVSI
PPDRLDLFGIRSIDPLEKELVRARAIPVVDMRAIDEFGVGVLIRRLIDRVRAANGVLHLS
FDVDVLDPAVAPGVGTTVPGGATYREAHLVMELLHDSGLVRSLDVVELNPFLDERGRTAR
VAVELIGSLFGMQISDRVTPSNALLPEG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgccctccagctccgtgatcccgcccgatccgaaccgccgcgtcgcgctgctcggg
gtgccgatcgagatcggcgccgggctgcgcggcacgctgatgggcccggcggcgctgcgc
accgcgggtatcggccgcgtgctcgaacagttgcgcatcaccgtcgaggatcacggcgac
atggcgcggccgccaccttgtcgcgacgcgggtccgacgccggccaacgccaattattac
gacgaggtgaaaagctgggtcggcgcgatctcggcgcgggcccatgagctggcgcgttcc
ggcgccgtgccgctgttcatgggcggcgatcacagcctgtcgatgggctcggtcaacggc
gtcgcgcgctattggcagacgcaggggcggccgctgttcgtgctgtggttcgacgcccac
gccgactacaacaccccggcgacgacgctctccgccaacatgcacggcatgtcggcggcg
ttcctgtgcggcgagccggggctcgatgcgctgctcggcgacgagccccgggtgtcgatc
ccgcccgaccggctcgacctgttcggcatccgatcgatcgatccgctggagaaggaattg
gtgcgcgcccgcgccatcccggtggtcgacatgcgggcgatcgacgaattcggcgtcggc
gtgctgatccgccggttgatcgaccgcgtccgcgcggcgaacggcgtgctgcatctgtcg
ttcgatgtcgacgtgctcgaccctgcggtcgcgcccggcgtcggcaccaccgtgccgggc
ggcgcgacctatcgggaggcgcatctggtgatggagctgctgcacgactcgggattggtg
cgttcgctcgacgtggtcgaactcaaccccttcctcgacgagcgcggccgcaccgcccgg
gtcgcggtggagctgatcggcagcctgttcggcatgcagatctccgaccgggtgacgccg
agcaacgcgctgctgcccgaggggtga

DBGET integrated database retrieval system