KEGG   Rhodopseudomonas palustris HaA2: RPB_0946Help
Entry
RPB_0946          CDS       T00321                                 

Definition
Iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPB_0946
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPB_0946
  Lipid metabolism
   00071 Fatty acid degradation
    RPB_0946
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPB_0946
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPB_0946
   00626 Naphthalene degradation
    RPB_0946
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPB_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1093541..1094728
Genome map
AA seq 395 aa AA seqDB search
MILPFSIARLPRIEFGAGAIARLPSLAAVYGKRLLLVTGARSFDHASYTAPLLAALRDQS
FSIARVPIRGEPSPEMVDDAVRECRRAEIDVVIGLGGGSALDAAKAIAGLLKPGNSVMDH
LEGVGPELPYRGPATPFIAVPTTAGTGSEATKNAVLSRHGPDGFKKSFRDEALVAEIALV
DPELLAGCPPALIAANGMDALTQLLESYVSTRANPFTDALALSGLRAVRDGLLAWYDGGD
AAGEARTQMAYASLLSGICLAQTGLGSVHGLASPLGAFFPIGHGVVCGTLVADATRVNIA
AMEARAPQHPALAKYAEIGRLLCGGSGSGAAQDRDALLRTLRHWTQRLSLPRLSSLGVAA
ADVDRIVAASRGSSMKTNPVVLTDDEIRLIVTSRF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcctttctcgatcgcccgtctgccccgcatcgaattcggcgcaggcgccatc
gcgaggttgccgagcctcgcagccgtctacggcaagcgcctgctgctggtcaccggtgca
cgctcgttcgatcatgcctcctatacggcgccgttgctggccgcgttgcgcgaccagagc
ttcagtatcgcgcgggtgccgatccgcggcgagccgtcgcccgagatggtcgacgacgcc
gtgcgggagtgtcgccgcgccgagatcgacgtcgtgatcggcctcggcggcggcagcgcg
ctcgatgccgccaaggcgatcgccgggctgctgaagcccggcaattcggtgatggaccat
ctcgaaggcgtcggccccgaactgccctatcgaggcccggcgacgccgttcatcgcggtg
ccgaccaccgccggcaccggctccgaggcgaccaagaacgcggtgttgtcccgtcacggc
cccgatggcttcaagaaatcgttccgcgatgaggcgctggtggccgagatcgcgctggtc
gacccagaactgttggccggctgcccgccagcgctgatcgcggccaacggcatggacgcg
ctgacccagttgctcgaatcctacgtctcgacccgcgccaatccgttcaccgacgcgctg
gcgctgtccggcctgcgcgcggtgcgggacggcctgctcgcctggtacgatggcggcgac
gccgcgggcgaggcgcgcacgcagatggcctacgcctcgctgctgtccggcatctgtctg
gcgcagaccgggctcggctctgtgcacggtctggcctcgccgctcggcgcgttcttcccg
atcggccacggcgtggtgtgcggcacgctggtcgcggatgccactcgcgtcaatatcgcc
gcaatggaagcgcgtgcgccgcaacatccggcgctggcgaaatacgccgagatcggccgc
ctgctgtgcggcggctccggcagcggcgcggcgcaggatcgcgacgctctgctgcgcacg
ctgcggcactggacgcagcgcctgtcgctgccgaggctgtcgtcgctcggcgtcgccgcc
gcggacgtcgatcggatcgtcgcggccagccgtgggtccagcatgaagaccaatccggtg
gtgctgaccgacgacgagatcaggctgatcgtgacctcgcgcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system