KEGG   Rhodopseudomonas palustris HaA2: RPB_0946Help
Entry
RPB_0946          CDS       T00321                                 

Definition
Iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:rpb01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpb00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rpb00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rpb00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rpb00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:rpb00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1093541..1094728
Genome map
AA seq 395 aa AA seqDB search
MILPFSIARLPRIEFGAGAIARLPSLAAVYGKRLLLVTGARSFDHASYTAPLLAALRDQS
FSIARVPIRGEPSPEMVDDAVRECRRAEIDVVIGLGGGSALDAAKAIAGLLKPGNSVMDH
LEGVGPELPYRGPATPFIAVPTTAGTGSEATKNAVLSRHGPDGFKKSFRDEALVAEIALV
DPELLAGCPPALIAANGMDALTQLLESYVSTRANPFTDALALSGLRAVRDGLLAWYDGGD
AAGEARTQMAYASLLSGICLAQTGLGSVHGLASPLGAFFPIGHGVVCGTLVADATRVNIA
AMEARAPQHPALAKYAEIGRLLCGGSGSGAAQDRDALLRTLRHWTQRLSLPRLSSLGVAA
ADVDRIVAASRGSSMKTNPVVLTDDEIRLIVTSRF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcctttctcgatcgcccgtctgccccgcatcgaattcggcgcaggcgccatc
gcgaggttgccgagcctcgcagccgtctacggcaagcgcctgctgctggtcaccggtgca
cgctcgttcgatcatgcctcctatacggcgccgttgctggccgcgttgcgcgaccagagc
ttcagtatcgcgcgggtgccgatccgcggcgagccgtcgcccgagatggtcgacgacgcc
gtgcgggagtgtcgccgcgccgagatcgacgtcgtgatcggcctcggcggcggcagcgcg
ctcgatgccgccaaggcgatcgccgggctgctgaagcccggcaattcggtgatggaccat
ctcgaaggcgtcggccccgaactgccctatcgaggcccggcgacgccgttcatcgcggtg
ccgaccaccgccggcaccggctccgaggcgaccaagaacgcggtgttgtcccgtcacggc
cccgatggcttcaagaaatcgttccgcgatgaggcgctggtggccgagatcgcgctggtc
gacccagaactgttggccggctgcccgccagcgctgatcgcggccaacggcatggacgcg
ctgacccagttgctcgaatcctacgtctcgacccgcgccaatccgttcaccgacgcgctg
gcgctgtccggcctgcgcgcggtgcgggacggcctgctcgcctggtacgatggcggcgac
gccgcgggcgaggcgcgcacgcagatggcctacgcctcgctgctgtccggcatctgtctg
gcgcagaccgggctcggctctgtgcacggtctggcctcgccgctcggcgcgttcttcccg
atcggccacggcgtggtgtgcggcacgctggtcgcggatgccactcgcgtcaatatcgcc
gcaatggaagcgcgtgcgccgcaacatccggcgctggcgaaatacgccgagatcggccgc
ctgctgtgcggcggctccggcagcggcgcggcgcaggatcgcgacgctctgctgcgcacg
ctgcggcactggacgcagcgcctgtcgctgccgaggctgtcgtcgctcggcgtcgccgcc
gcggacgtcgatcggatcgtcgcggccagccgtgggtccagcatgaagaccaatccggtg
gtgctgaccgacgacgagatcaggctgatcgtgacctcgcgcttctga

DBGET integrated database retrieval system