KEGG   Rhodopseudomonas palustris HaA2: RPB_1086Help
Entry
RPB_1086          CDS       T00321                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rpb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1247765..1248655
Genome map
AA seq 296 aa AA seqDB search
MPTTALSDQARAKVNLTLRVVGRRVDGYHDLESVVAFADCADRLTLHPGAELSLVTSGPG
AQDCGDTADNLVLKATRLLAERVPKLRSGAFVLDKHLPVAAGIGGGSADAAAALRLLARA
NDLAADDPRVVEAARLTGADVPVCLPSRPCVMTGVGDTLTPLPLPRLPAVMVNPRVPVAT
KDVFKALGLRAGQLNVGIVDVLKSKGWPAVDASVADWIVAVRRGTNDLEAPALKVEPIVG
DVLRALAALPGVRMSRMSGSGATCFALFASDEDTKAGAEVLRAAHPGWWIHAGSLS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgccgacaacggcgttgagcgaccaggcccgcgccaaggtcaatctcactttgcgagtc
gtgggccgccgcgtcgacggctatcacgacctcgaaagcgtggtggccttcgccgattgc
gccgaccgcctgacgttgcatccgggtgccgaactgagcctcgtcacctccggccccggc
gcgcaggattgcggcgacaccgccgacaatctggtgctcaaggcgacccgactgctcgcc
gagcgcgtcccgaaactgcgcagcggcgccttcgtcctcgacaagcatctgccggtcgcg
gccgggatcggtggcggctcggccgacgccgccgcggcgttgcggctgctcgcccgcgcc
aacgatctggcggccgacgatccgcgcgtggtcgaggcggcgcgtctcaccggggccgac
gtgccggtatgcctgccgtcccggccctgcgtcatgaccggagtcggcgatacgctgacg
ccgttgccgctgccgcggctgccggcggtgatggtcaatccgcgcgtgccggtggcgacc
aaggacgtgttcaaggcgctcggcctgcgtgccggtcagctcaatgtcggcattgtcgac
gtgctgaaatcgaagggctggcccgcggtggatgcgtccgttgccgactggatcgtggcg
gtgaggcgcggcacgaacgatctcgaggccccggcgctgaaggtcgagccgatcgtcggc
gatgtgctgcgggcgctcgccgcgctgccgggggtgcggatgtcgcggatgtccggctcc
ggcgcgacctgctttgcgctgttcgccagcgatgaagatacgaaggccggcgccgaggtg
ctacgcgccgcgcatcccggctggtggatccacgccggcagcctgagctag

DBGET integrated database retrieval system