KEGG   Rhodopseudomonas palustris HaA2: RPB_1395Help
Entry
RPB_1395          CDS       T00321                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rpb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rpb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1584818..1586992)
Genome map
AA seq 724 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAKEAAPKTGVAPDAFWAGLAAIVRDLTPKTVALLQHRDGLQ
AKIDAWHLANKGKKQDMAAYTAFLKEIGYLLPEPPTVAVETANVDDEIGKLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPQEASQAKGYDKARGDKVIAKAKAFLDQAAPLV
AGSHSDVTAYSVIAGQLSAKLKSGNATGLKTPRQFAGYLGDAASPSAVLLVNNGLHIEIK
IDRANTIGKDDAAGVADLVIESAVSTILDMEDSVAAVDAEDKVLIYRNTLGLMDGTLSAD
FDKGGKTVTRALNGDRTYTGPDGKDVTLHGRSLLLMRNVGHHMWTDAVLDSNGDEIPEGF
LDAAVSGLLAIHDLKALGKTRNSRTGSVYIVKPKMHGPDEVALTCELFGRVEQMLGLKEN
TLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWIKAYEDWNVDTGLIDGLPGHAQIGKGMWAAPDKMADMLTQKIGHPQAGATTAWVPSP
TAATLHALHYHQVDVLARQQELKTGGPRAKLEDILTIPVSQSNWAPDDVRQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKEQVLESLKRM
AAVVDKQNAGDPLYRPMAPDFDGVAFEAACDLIFKGREQPNGYTEFILHIRRREAKAAHL
QDLT
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcgatgcccacggcttgaaaattgcgcccgtcctgttcgacttcatcgcc
aaggaggccgcgccgaagaccggcgtcgcaccggacgccttctgggccgggctcgccgcg
atcgtgcgcgatctgacgccgaagacggtcgcgctgctgcagcatcgcgacggcctgcag
gccaagatcgatgcctggcatctcgccaacaagggcaagaagcaggacatggcggcctac
accgccttcctgaaagagatcggctatctgctgccggagccgccgacggtcgcggtcgag
accgccaatgtcgacgacgagatcggcaagctgtgcggcccgcagctcgtggtgccgctg
tcgaatgcgcgctacgcactcaacgcggcgaacgcgcgttggggctcgctgtatgacgcg
ttctatggcaccgacgcgatcccgcaggaggccagccaggccaagggctacgacaaggcg
cgcggcgacaaggtgatcgccaaggccaaggcgttcctcgaccaggccgcgccgctggtg
gccggcagccacagcgacgtcaccgcctacagcgtgatcgccggccagctttcggcaaaa
ctcaagagcggcaacgccaccggcctgaagaccccccggcagttcgccggctatctgggc
gacgccgcgtcgccgagcgcggtgctgctggtcaataacggcctgcatatcgagatcaag
atcgaccgcgccaataccatcggcaaggacgatgcggccggcgtcgccgacctcgtgatc
gaatccgcggtgtcgaccatcctcgacatggaggactcggtcgcagccgtcgacgccgaa
gacaaggtgctgatctaccgcaacacgctcggcctgatggacggcacgctgtcggccgat
ttcgacaagggtggcaagaccgtcacccgcgcgctgaacggcgaccgcacttataccggc
ccggacggcaaggacgtcaccctgcacgggcgcagcctgctgctgatgcgcaatgtcggc
catcacatgtggaccgatgcggtgctcgattcgaacggcgacgagatccccgagggcttc
ctcgacgccgcggtgtccggcctactggcgatccacgacctcaaggcactcggcaagacc
cgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccggacgaa
gtggcgctgacttgcgagctgttcggccgcgtcgagcagatgctcggcctgaaggagaac
acgctgaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctcaaggcctgc
atccagaacgcgtccaagcgcatcgtgttcatcaacacgggtttcctggaccgcaccggc
gacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccctggatcaaggcgtacgaggactggaacgtcgacaccggcctgatcgacggcctg
cccggccatgcccagattggtaagggcatgtgggcggcccccgacaagatggccgacatg
ctgacgcagaagatcggccacccgcaggccggcgccaccaccgcctgggtgccgtcgccg
accgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgctggcgcgtcagcag
gagctgaagacgggcggcccgcgcgccaagctcgaggacatcctcaccatcccggtgtcg
caatcgaattgggcgccggacgacgtccgccaggagatcgacaacaactgccagggtatc
ctcggctacgtcgtgcgctggatcgatcagggcgtcggctgctccaaggtgccggacatc
cacgacgtcggcctgatggaagaccgcgccacgctgcgcatctccagccagcatctggcg
aactggctgcatcacggcgtcgtcaccaaggagcaggtgctggaatcgctgaagcggatg
gcggcggtggtcgacaagcagaacgctggtgatccgctgtaccggccgatggcgccggac
ttcgacggcgtcgccttcgaggcggcgtgcgacctgatcttcaagggccgcgagcagccg
aacggctacaccgaattcatcctgcatatccgccgccgcgaagccaaggcggcgcatctg
caggacctgacctga

DBGET integrated database retrieval system