KEGG   Rhodopseudomonas palustris HaA2: RPB_1395Help
Entry
RPB_1395          CDS       T00321                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPB_1395
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPB_1395
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_1395
Enzymes [BR:rpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPB_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1584818..1586992)
Genome map
AA seq 724 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAKEAAPKTGVAPDAFWAGLAAIVRDLTPKTVALLQHRDGLQ
AKIDAWHLANKGKKQDMAAYTAFLKEIGYLLPEPPTVAVETANVDDEIGKLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPQEASQAKGYDKARGDKVIAKAKAFLDQAAPLV
AGSHSDVTAYSVIAGQLSAKLKSGNATGLKTPRQFAGYLGDAASPSAVLLVNNGLHIEIK
IDRANTIGKDDAAGVADLVIESAVSTILDMEDSVAAVDAEDKVLIYRNTLGLMDGTLSAD
FDKGGKTVTRALNGDRTYTGPDGKDVTLHGRSLLLMRNVGHHMWTDAVLDSNGDEIPEGF
LDAAVSGLLAIHDLKALGKTRNSRTGSVYIVKPKMHGPDEVALTCELFGRVEQMLGLKEN
TLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWIKAYEDWNVDTGLIDGLPGHAQIGKGMWAAPDKMADMLTQKIGHPQAGATTAWVPSP
TAATLHALHYHQVDVLARQQELKTGGPRAKLEDILTIPVSQSNWAPDDVRQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKEQVLESLKRM
AAVVDKQNAGDPLYRPMAPDFDGVAFEAACDLIFKGREQPNGYTEFILHIRRREAKAAHL
QDLT
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcgatgcccacggcttgaaaattgcgcccgtcctgttcgacttcatcgcc
aaggaggccgcgccgaagaccggcgtcgcaccggacgccttctgggccgggctcgccgcg
atcgtgcgcgatctgacgccgaagacggtcgcgctgctgcagcatcgcgacggcctgcag
gccaagatcgatgcctggcatctcgccaacaagggcaagaagcaggacatggcggcctac
accgccttcctgaaagagatcggctatctgctgccggagccgccgacggtcgcggtcgag
accgccaatgtcgacgacgagatcggcaagctgtgcggcccgcagctcgtggtgccgctg
tcgaatgcgcgctacgcactcaacgcggcgaacgcgcgttggggctcgctgtatgacgcg
ttctatggcaccgacgcgatcccgcaggaggccagccaggccaagggctacgacaaggcg
cgcggcgacaaggtgatcgccaaggccaaggcgttcctcgaccaggccgcgccgctggtg
gccggcagccacagcgacgtcaccgcctacagcgtgatcgccggccagctttcggcaaaa
ctcaagagcggcaacgccaccggcctgaagaccccccggcagttcgccggctatctgggc
gacgccgcgtcgccgagcgcggtgctgctggtcaataacggcctgcatatcgagatcaag
atcgaccgcgccaataccatcggcaaggacgatgcggccggcgtcgccgacctcgtgatc
gaatccgcggtgtcgaccatcctcgacatggaggactcggtcgcagccgtcgacgccgaa
gacaaggtgctgatctaccgcaacacgctcggcctgatggacggcacgctgtcggccgat
ttcgacaagggtggcaagaccgtcacccgcgcgctgaacggcgaccgcacttataccggc
ccggacggcaaggacgtcaccctgcacgggcgcagcctgctgctgatgcgcaatgtcggc
catcacatgtggaccgatgcggtgctcgattcgaacggcgacgagatccccgagggcttc
ctcgacgccgcggtgtccggcctactggcgatccacgacctcaaggcactcggcaagacc
cgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccggacgaa
gtggcgctgacttgcgagctgttcggccgcgtcgagcagatgctcggcctgaaggagaac
acgctgaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctcaaggcctgc
atccagaacgcgtccaagcgcatcgtgttcatcaacacgggtttcctggaccgcaccggc
gacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccctggatcaaggcgtacgaggactggaacgtcgacaccggcctgatcgacggcctg
cccggccatgcccagattggtaagggcatgtgggcggcccccgacaagatggccgacatg
ctgacgcagaagatcggccacccgcaggccggcgccaccaccgcctgggtgccgtcgccg
accgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgctggcgcgtcagcag
gagctgaagacgggcggcccgcgcgccaagctcgaggacatcctcaccatcccggtgtcg
caatcgaattgggcgccggacgacgtccgccaggagatcgacaacaactgccagggtatc
ctcggctacgtcgtgcgctggatcgatcagggcgtcggctgctccaaggtgccggacatc
cacgacgtcggcctgatggaagaccgcgccacgctgcgcatctccagccagcatctggcg
aactggctgcatcacggcgtcgtcaccaaggagcaggtgctggaatcgctgaagcggatg
gcggcggtggtcgacaagcagaacgctggtgatccgctgtaccggccgatggcgccggac
ttcgacggcgtcgccttcgaggcggcgtgcgacctgatcttcaagggccgcgagcagccg
aacggctacaccgaattcatcctgcatatccgccgccgcgaagccaaggcggcgcatctg
caggacctgacctga

DBGET integrated database retrieval system