KEGG   Rhodopseudomonas palustris HaA2: RPB_1408Help
Entry
RPB_1408          CDS       T00321                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPB_1408
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPB_1408
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPB_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1599501..1600346
Genome map
AA seq 281 aa AA seqDB search
MRSNSGAQPFLQTIEQEQMMTNLTGKTAVVTGSTSGIGLAYARAFAKAGANVVLNGMGEA
DAIEKERKAIETDFGVKAVYSPADMLKPAEIAEMVGLGETTFGSVDILVNNAGIQFVSPV
EDFPIEKWDAIIGINLSSAFHGIRAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVAAK
HGIAGLTKTVALEVATHKITCNCISPGYVWTPLVEKQIPDTMKARGLTKEQVINDVLLLA
QPTKQFVTSEQVAALAVYLCSDDASQITGANLSMDGGWTAA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaaatagcggcgcgcagccgtttttgcagacgatcgaacaggagcagatgatg
acgaacctcacgggcaagaccgcggtcgtgaccggctcgacctcgggcatcggcctcgct
tacgcgcgcgccttcgccaaggccggcgccaatgtggtgttgaacggcatgggcgaggcg
gacgcgatcgaaaaggagcgcaaggcgatcgagaccgatttcggcgtgaaggcggtgtat
tcgccggccgacatgctgaagcccgccgagatcgccgagatggtcgggctcggcgagacg
acgttcggctcggtcgacatcctggtcaacaacgccggcattcagttcgtctcgccggtc
gaggattttccgatcgagaaatgggacgcgatcatcggcatcaacttgtcgtcggcgttc
cacggcatccgcgccgcggtgccgggcatgaagaagcgcggctggggccgcatcatcaac
accgcctcggcccactcgctggtcgcctcgccgttcaagtcggcctatgtcgccgccaag
cacggcatcgccggcctgaccaagacggtggcgctcgaagtcgcgacccacaagatcacc
tgcaactgcatttcgccgggctatgtctggacgccgctggtcgagaagcagatccccgac
accatgaaggcgcgcggcctcaccaaggagcaggtgatcaacgacgtgctgctgctggct
caaccgaccaagcagttcgtcacctccgagcaggtcgccgccctcgcggtctatctgtgc
agcgacgacgccagccagatcaccggcgccaatctgtcgatggacggcggctggaccgcg
gcgtaa

DBGET integrated database retrieval system