KEGG   Rhodopseudomonas palustris HaA2: RPB_1548Help
Entry
RPB_1548          CDS       T00321                                 

Definition
(GenBank) Asparagine synthase, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00250  Alanine, aspartate and glutamate metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RPB_1548
Enzymes [BR:rpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RPB_1548
Peptidases [BR:rpb01002]
 Cysteine Peptidases
  Family C44
   RPB_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ABD06258
JGI: RPB1548
UniProt: Q2IZV2
Position
1744455..1746398
Genome map
AA seq 647 aa AA seqDB search
MCGVAGVASARGVRVEFEILKRMTDALAHRGPDGEGHWLSEDGEVALGHRRLSIIDLSSH
GAQPMVSASGRFAMSYNGEVYNYLELRDELLRAGYPFHGQSDTEVIVAGFDHWGIENTIS
RLAGMFVIAVWDRRDKTLSLVRDRIGIKPLYYSVIDGALAFASELRPIVVWRGSLPEISR
RGLSEFLRLGYVPSPLSIFEGVFKLPPATIATFSGGHLSEPKPYWSVDATVARGFANLRM
DETEVLDQLDTRLGDIVAQHMVSDVPLGAFLSGGIDSSVVTALMQARSSSAVKTFSIGFD
SAAYNEAGYAAEVAAHLGTDHTELYITEADALAVVPSLPDIYDEPFADISQIPTFLVAEL
ARQKVTVSLSGDGGDELFGGYNRYMFVSNYWSRLSKIPLPLRRVAASAIAAPSSAGWDRI
FDLLGPMLPGNARPALPGQKMQKIGSVLSAASLSELQGRLIAQWPHPEAVMAQGFGAGSA
LMLPPASQVPDLPAAAQQMAWDTSSYLVDDILTKVDRATMRVGLEARVPLLDHRLVEFAW
EIPLDMKFRDGSGKHILKRLLGRYVPRAMFDRPKMGFGVPVDDWLRGPLREWAASYLAAA
RHGDDYLDRGVIAATWKEHLNGKINRGGQLWTILMFDIWHQRIRQWV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtgtcgccggcgtcgcgagtgcccggggagtccgggtcgagttcgagatcctg
aagcggatgaccgatgcgctcgcgcatcgcggcccggatggagaggggcactggctgtcc
gaggacggcgaggtcgcgctcgggcaccgacggctgtcgatcatcgatctgtcctcgcac
ggcgctcagcccatggtgtcggcgtccggcagattcgcgatgtcctacaacggcgaagtc
tacaactacctggagctgcgcgacgagctgctgcgcgccggctatccgttccacggccag
tcggacaccgaagtcatcgtcgcgggtttcgaccattggggaatcgaaaacaccatatcg
aggctggcgggcatgttcgtgatcgcggtctgggaccggcgcgacaagaccttgtcgctg
gtccgcgaccgcatcggcatcaagccgctgtactactcagtgatcgacggtgcgctggct
ttcgcatccgaactgcggccgatcgttgtttggcgaggcagccttccggagatctcccgt
cgcggcctctcggaattcctgcggctcggatacgttccctcgccactgagcattttcgag
ggggttttcaagcttccgccggcgacgatcgccaccttcagcggtgggcatctgtccgaa
ccgaagccttactggtcggtcgatgcaacggttgcacgcggtttcgccaatctgaggatg
gacgagaccgaggttctcgatcagcttgatacccggttgggggatatcgtcgcccagcat
atggtttccgatgttccgctgggcgccttcctgtccggtggcatcgattccagcgtcgtg
accgcgctgatgcaggccagaagctcgtcggccgtcaagacgttctcgatcggtttcgac
agtgccgcttacaatgaggccggctacgccgccgaggttgcggcgcatctcggcacagat
cacaccgaactctacatcaccgaagcggatgcgctggcggtggtgccgtcgcttcccgac
atctacgatgagcctttcgcagacatctcgcaaattccgaccttcctcgtcgccgagctg
gcgcgccaaaaggtcactgtgagcctctcgggcgacggcggcgacgaattgttcggcggc
tacaatcgctacatgttcgtttcgaactactggagccggctcagcaagattccgctcccg
ctgcgacgcgtggcggcgtcggccatcgccgcgccgtcgtcggccggctgggacaggata
ttcgacctgcttggaccgatgttgcctgggaatgcgcgccccgcattgcctggacaaaag
atgcagaagatcggttcggtgctgtcggcggcctccctgtccgagttgcaggggcggctg
atcgcccaatggccccatccagaagccgtcatggcgcagggctttggtgcaggctcggcg
ctgatgctgcccccggcgtcgcaagttcccgatcttcccgccgcggcgcagcagatggca
tgggataccagcagctatctggtcgatgatattctgacgaaggtcgatcgtgccaccatg
cgggtgggtctcgaggctcgcgtcccgctattggatcaccgcctggtcgagttcgcctgg
gagattccgctggacatgaagttccgagacgggtccggcaagcacatcctgaagcggttg
ctcggtcgctacgttccgcgcgcgatgttcgaccgtcccaagatggggtttggcgttccg
gtggacgactggctcagggggcctctcagggaatgggcggcgagctatcttgccgcggct
cgtcacggcgatgactatctcgaccgcggcgtcatcgcggcgacgtggaaagagcatctg
aacggcaagatcaaccgcggcggacagctttggacaatcctgatgtttgatatctggcac
cagagaattcgccaatgggtgtga

DBGET integrated database retrieval system