KEGG   Rhodopseudomonas palustris HaA2: RPB_1763Help
Entry
RPB_1763          CDS       T00321                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RPB_1763
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RPB_1763
Exosome [BR:rpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPB_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2016846..2018351
Genome map
AA seq 501 aa AA seqDB search
MPFVMAIDQGTTSSRAILFRGDISIAASAQQEFPQHFPASGWVEHEPEDIWASTLATCRA
AMEKAGATAADIAAIGITNQRETVVVWDAASGKAIHRAIVWQDRRTAEVCTRMKADGYEP
MITDKTGLIIDPYFSGTKVAWLLDNVPGARARAERGELKFGTIDCWLLWRLTGGRVHATD
ATNASRTLLFNIHTGDWDDELLQLLRVPRSMLPEVKDSSAHFGDSAYELFGAPIAIRGIA
GDQQAATIGQACFSPGMIKSTYGTGCFALLITGATPVKSHNKLLTTIAYQLGGKRTYALE
GSIFVAGSAVQWLRDGLGIIKHASETGPLADKSDSMQSVYLVPAFVGLGAPYWNPRVRGA
LFGMTRNTGPAELAHAALESVCYQTYDLWAAMRADWSGADAAPPVLRVDGGMAASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLSAGVFPEPQKFADNWRLDHRFRPAMSQATRE
RKLAGWGRAVKGLLASDEGEG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgtgatggccatcgatcagggcaccacttcgtcgcgcgcgatcctgttccgt
ggcgatatttcgatcgcggcctcggcgcagcaggaattcccgcagcatttccccgcctcc
ggctgggtcgagcacgagcccgaggacatctgggcctcgacgctggcgacctgccgggcc
gcgatggagaaggcaggggccaccgccgccgatatcgccgcgatcggcatcaccaaccag
cgggagaccgtggtggtgtgggacgcggcgtccggcaaggcgatccaccgcgccatcgtc
tggcaggatcgccgcaccgcggaggtctgcacccgcatgaaggcggacggctatgagccg
atgatcaccgacaagaccgggctgatcatcgatccgtatttctccggcaccaaggtcgcc
tggctactcgacaacgtgcccggcgcgcgcgcccgcgccgagcgcggcgaactcaaattc
ggcaccatcgattgctggctgctgtggcggctgaccggcggccgcgtccacgccaccgac
gccaccaacgcctcgcgcacgctgctgttcaacatccacaccggcgattgggacgacgag
ctgctgcagctgctgcgcgtgccgcgctcgatgttgccggaggtcaaggattcctccgcg
catttcggcgacagcgcctacgaactgttcggtgccccgatcgccattcgcggcatcgcc
ggcgaccagcaggccgccaccatcgggcaggcctgtttctcgccgggcatgatcaaatcg
acttacggcaccggctgcttcgccctgctcatcaccggcgcgacgccggtgaagtcgcac
aacaagctgctcaccaccatcgcctatcagctcggcggtaagcgtacctacgcgctggag
ggctcgatcttcgtcgcgggctcggcggtgcaatggctgcgcgacggcctcggcatcatc
aagcacgccagcgagaccggccccctcgccgacaaatccgattcgatgcagagcgtttat
ctggtgccggccttcgtcggcctcggcgcgccgtactggaatccgcgagtgcgcggcgcg
ctgttcggcatgacgcgcaacaccggcccggccgagctggcgcacgccgcgctggagagc
gtctgctatcagacctacgatctatgggcggcgatgcgcgccgactggtcgggcgccgac
gccgcgccgccggtgctgcgcgtcgacggcggcatggcggcgtcggactggaccatgcag
cgcctcgccgatctcctcgacgccccggtagaccgccccgtgatccaggaaaccaccgcg
ctcggcgccgcgtatctcgccggcctctcagccggcgtcttccccgagccgcagaaattc
gccgacaactggcgcctcgaccaccgcttcaggccggcgatgagccaggcgacgcgcgag
aggaagctggcgggatggggcagggcggtgaaggggctgctggcgagtgatgagggggag
gggtag

DBGET integrated database retrieval system