KEGG   Rhodopseudomonas palustris HaA2: RPB_1897Help
Entry
RPB_1897          CDS       T00321                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rpb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rpb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2171722..2172198
Genome map
AA seq 158 aa AA seqDB search
MASIYDFSARTLAGEELPLKRFEGQVLLIVNTASACGFTPQYKGLEALQQKYGARGFSVL
GFPCNQFGAQESGSEAQIAQFCSTHYGVSFPMFAKIDVNGAQAHPLYTFLKDEKGGLLGS
AIKWNFTKFLVDRSGHVISRHAPTTTPESLAKDIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatttatgatttttcggccaggacgcttgcgggcgaagagctgccgctgaag
cggttcgaggggcaggtgctgctgatcgtcaacaccgccagtgcctgcggattcacgccg
caatacaagggcctcgaagcactacagcagaaatacggcgcgcgcggattttcggtgctc
ggcttcccctgcaaccagttcggcgcgcaggaatccggcagcgaggcgcagatcgcgcaa
ttctgctcgacccattacggcgtcagtttcccgatgttcgccaagatcgacgtcaatggc
gcgcaggcgcatccgctgtacacatttctcaaggacgagaagggcgggttgctcggctcg
gcgatcaaatggaatttcaccaaatttctggtcgatcggtccggccatgtgatatcgcgg
cacgcgccgacgaccacgccggagtcgctcgcaaaggatatcgagaccttgctatga

DBGET integrated database retrieval system