KEGG   Rhodopseudomonas palustris HaA2: RPB_2064Help
Entry
RPB_2064          CDS       T00321                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rpb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2345626..2347374
Genome map
AA seq 582 aa AA seqDB search
MCAIAGLVSLDAPPHVRPILDAIRHRGPDGLGTHRDGACEIGAARLAIVDPERGAQPMRD
PLSQTAVAFNGEIYNADELRRMLIARGHRFATRCDTEVVLRGFLEWGLDLPTHLSGMYAI
AVLERGRLTLIRDPLGIKPLRYAQRGAQFAFASEAKALLRWFGPPRLDETALADFIAIGY
PTGRHTFFAGISTLPPGHLLTVNWGQGLHVAEPRPYQLRTPPPQLQLCEDEAELAFVDAL
LAATNSHLQADTEVVAVLSGGIDSAMLACTAAELSGRRLRTFTVADTAEHPDAVAAARVA
RAIGADHTLLTFGFDDYLAAIPATIAAVEAPDLHAGPFFHLLCQVIGGCAKVCLNGEGAD
ETLGGYYDPAGTIATLTDGQARAQAAGLVPSDRACAIRDGLLEAAAKGAAGIRATLDISL
QDLLERAQLDPVDHLSMAAGVEMRVPYLDPVVQAVVRRVPPGEIVDTSLGITKRLLRRAA
VRRHGAHLLDSALRAKMMMPHASGGHAARFAQACDHAVPDDALRRLPFGAGFASKTDVVL
FELFRRIHLDGGGAAVKIDDVFAEIAGSSRAGASAIAQAAAS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccatagccggactcgtctcgctcgatgcgccgccgcacgtgcggccgatcctc
gacgccatccgccatcgcggcccggatgggctcggcacgcatcgcgacggcgcctgcgag
atcggcgcggcgcggctcgcgatcgtcgatcccgaacgcggcgcgcagccgatgcgcgat
ccgctgtcgcagaccgcggtcgcgttcaacggcgagatctacaacgccgacgaattgcgc
cgcatgctgatcgcgcgcgggcaccgcttcgcgacgcgctgcgacacggaagtggtgctg
cgcggcttcctcgaatgggggctggatctgccaacgcatctgtccggcatgtacgcgatc
gcggtgctggaacgcgggcggctgacgctgatccgcgatccgctcggcatcaagccgctg
cgctatgcgcagcgcggcgcgcaattcgcgttcgcctcggaggccaaggcgctgctgcgc
tggttcggcccgccgcgtctcgacgagacggcgttggccgatttcatcgcgatcggctat
ccgaccggccgccacaccttcttcgccgggatctcgacgctgccgcccggccatctgctg
acggtaaactgggggcaggggctgcacgtcgccgagccgcggccgtatcaactacgcacc
ccgccgccgcagttgcaattgtgcgaggacgaggccgaactcgctttcgtcgacgcgctg
ctggcggcgacgaacagccatctgcaggccgacaccgaggtcgtggcggtgctgtccggc
ggcatcgattccgcgatgctggcctgcaccgcggcggaactgtcgggccgcaggctgcgc
accttcaccgtcgccgacaccgccgagcatcccgacgccgtcgccgccgcgcgcgtggcg
cgggcgatcggcgccgatcacacgctgctgaccttcggcttcgacgattacctcgcggca
attccggcgaccatcgcggcggtcgaggcgcccgatctgcatgccgggccgttcttccat
ctgctgtgccaggtgatcggcggctgcgccaaagtctgcctcaacggcgaaggcgccgac
gagacgctcggcggctactacgatccggccgggacgatcgccacgctcaccgacggccag
gcgcgcgcgcaggccgcggggctcgttcccagcgaccgcgcctgcgccattcgcgacggc
ctgctcgaagccgccgcgaaaggcgccgccggcatccgcgccacgctcgacatttcgctg
caggatctgctggagcgcgcccagctcgatccggtggatcatctgtcgatggccgcgggc
gtcgagatgcgggtgccctatctcgaccccgtggtgcaggcggtggtgcggcgcgtgccg
ccgggcgagatcgtcgatacgtcgctcggcatcaccaagcggctgctgcgccgcgccgcg
gtgcgccgccacggcgcgcatctgctcgacagcgcgctgcgcgccaagatgatgatgccg
cacgcctccggcggccacgccgcgcgctttgcccaggcctgcgatcacgcggtgcccgac
gacgcgctgcgtcgtctgccgttcggcgcgggcttcgccagcaagaccgatgtcgtgctg
ttcgaactgttccgccggatccatctcgacggcggcggcgctgcagtgaaaatcgacgac
gtgttcgccgagatcgccggatcgtcgcgcgccggcgcgagcgcgatcgcgcaggcggcc
gcgtcatga

DBGET integrated database retrieval system